Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE6BOK3)

DME Name Beta,beta-carotene 15,15'-dioxygenase (BCO1)
Synonyms Beta-carotene dioxygenase 1; Beta-carotene oxygenase 1; BCDO; BCDO1; BCMO1; BCO1
Gene Name BCO1
UniProt ID
BCDO1_HUMAN
INTEDE ID
DME0084
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
53630
EC Number EC: 1.13.11.63
Oxidoreductase
Oxygen single donor oxidoreductase
Oxygen single donor oxidoreductase
EC: 1.13.11.63
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MDIIFGRNRKEQLEPVRAKVTGKIPAWLQGTLLRNGPGMHTVGESRYNHWFDGLALLHSF
TIRDGEVYYRSKYLRSDTYNTNIEANRIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDF
TDNCLINIMKCGEDFYATSETNYIRKINPQTLETLEKVDYRKYVAVNLATSHPHYDEAGN
VLNMGTSIVEKGKTKYVIFKIPATVPEGKKQGKSPWKHTEVFCSIPSRSLLSPSYYHSFG
VTENYVIFLEQPFRLDILKMATAYIRRMSWASCLAFHREEKTYIHIIDQRTRQPVQTKFY
TDAMVVFHHVNAYEEDGCIVFDVIAYEDNSLYQLFYLANLNQDFKENSRLTSVPTLRRFA
VPLHVDKNAEVGTNLIKVASTTATALKEEDGQVYCQPEFLYEGLELPRVNYAHNGKQYRY
VFATGVQWSPIPTKIIKYDILTKSSLKWREDDCWPAEPLFVPAPGAKDEDDGVILSAIVS
TDPQKLPFLLILDAKSFTELARASVDVDMHMDLHGLFITDMDWDTKKQAASEEQRDRASD
CHGAPLT
Function This enzyme symmetrically cleaves beta-carotene into two molecules of retinal using a dioxygenase mechanism.
KEGG Pathway
Metabolic pathways (hsa01100 )
Retinol metabolism (hsa00830 )
Reactome Pathway
Retinoid metabolism and transport (R-HSA-975634 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Beta-carotene DM0RXBT Vitamin deficiency 5B55-5B71 Approved [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
Beta-carotene Vitamin deficiency [5B55-5B71] Approved Km = 0.0172 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.04E-02 2.96E-02 1.79E-01
Alopecia ED70 Skin from scalp 7.39E-01 -4.72E-02 -1.16E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.00E+00 1.01E-02 3.72E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 8.09E-01 1.75E-02 1.87E-01
Aortic stenosis BB70 Calcified aortic valve 7.39E-01 6.15E-02 9.41E-02
Apnea 7A40 Hyperplastic tonsil 1.76E-02 -8.39E-01 -7.82E-01
Arthropathy FA00-FA5Z Peripheral blood 2.55E-02 1.13E-01 8.72E-01
Asthma CA23 Nasal and bronchial airway 9.50E-06 1.25E+00 9.09E-01
Atopic dermatitis EA80 Skin 5.15E-02 -9.73E-02 -3.24E-01
Autism 6A02 Whole blood 4.60E-01 4.17E-02 2.37E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.11E-01 1.38E-01 7.83E-01
Autosomal dominant monocytopenia 4B04 Whole blood 3.70E-01 6.09E-02 3.28E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.03E-10 -5.27E-01 -9.85E-01
Batten disease 5C56.1 Whole blood 2.80E-01 9.21E-02 8.03E-01
Behcet's disease 4A62 Peripheral blood 9.34E-01 -4.39E-02 -2.92E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.35E-01 -6.53E-03 -4.10E-02
Bladder cancer 2C94 Bladder tissue 2.03E-03 2.13E-01 1.29E+00
Breast cancer 2C60-2C6Z Breast tissue 6.55E-04 -8.79E-02 -3.46E-01
Cardioembolic stroke 8B11.20 Whole blood 7.15E-02 1.05E-01 6.28E-01
Cervical cancer 2C77 Cervical tissue 1.15E-02 -3.59E-01 -8.71E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.86E-01 5.66E-02 2.22E-01
Chronic hepatitis C 1E51.1 Whole blood 9.20E-01 -1.54E-03 -6.38E-03
Chronic obstructive pulmonary disease CA22 Lung tissue 1.35E-01 7.84E-02 4.82E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.89E-01 -1.89E-02 -7.06E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.27E-02 1.34E-01 1.16E+00
Colon cancer 2B90 Colon tissue 2.28E-21 -5.46E-01 -1.04E+00
Coronary artery disease BA80-BA8Z Peripheral blood 6.41E-01 -6.98E-02 -4.10E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.61E-01 -5.97E-02 -3.47E-01
Endometriosis GA10 Endometrium tissue 1.09E-03 1.37E-01 3.93E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.81E-01 3.85E-02 4.50E-01
Familial hypercholesterolemia 5C80.00 Whole blood 9.07E-01 -5.45E-02 -3.48E-01
Gastric cancer 2B72 Gastric tissue 3.07E-01 4.60E-01 5.88E-01
Glioblastopma 2A00.00 Nervous tissue 1.18E-42 2.70E-01 8.63E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.44E-01 6.81E-02 5.18E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.25E-01 -1.83E-01 -5.71E-01
Head and neck cancer 2D42 Head and neck tissue 2.81E-04 -2.36E-01 -7.97E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.14E-01 4.63E-02 5.74E-01
Huntington's disease 8A01.10 Whole blood 7.84E-01 -7.53E-03 -5.72E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.64E-01 2.03E-02 1.95E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.29E-01 6.05E-02 5.20E-01
Influenza 1E30 Whole blood 8.79E-01 -3.96E-02 -3.60E-01
Interstitial cystitis GC00.3 Bladder tissue 4.77E-01 -9.54E-02 -9.37E-01
Intracranial aneurysm 8B01.0 Intracranial artery 3.09E-01 -5.42E-02 -3.26E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.05E-01 2.52E-02 4.63E-02
Ischemic stroke 8B11 Peripheral blood 3.23E-01 1.11E-02 6.71E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 3.54E-02 5.93E-02 2.32E-01
Lateral sclerosis 8B60.4 Skin 1.31E-02 1.08E-01 2.34E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 5.19E-01 -1.71E-02 -4.35E-02
Liver cancer 2C12.0 Liver tissue 9.37E-01 -8.53E-02 -3.01E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.10E-01 -1.00E-01 -4.70E-01
Lung cancer 2C25 Lung tissue 1.24E-74 2.66E-01 1.47E+00
Lupus erythematosus 4A40 Whole blood 9.26E-01 -4.18E-02 -1.37E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.89E-01 -1.04E-02 -6.17E-02
Major depressive disorder 6A70-6A7Z Whole blood 2.17E-01 7.89E-02 2.51E-01
Melanoma 2C30 Skin 2.71E-01 -8.39E-02 -1.58E-01
Multiple myeloma 2A83.1 Peripheral blood 3.55E-01 1.26E-01 9.05E-01
Multiple myeloma 2A83.1 Bone marrow 1.40E-01 -1.44E-01 -9.70E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.43E-02 1.96E-01 1.21E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.51E-04 7.39E-02 4.55E-01
Myelofibrosis 2A20.2 Whole blood 2.22E-02 -5.33E-02 -3.89E-01
Myocardial infarction BA41-BA50 Peripheral blood 7.96E-01 3.86E-02 5.43E-02
Myopathy 8C70.6 Muscle tissue 5.42E-01 -5.56E-02 -2.24E-01
Neonatal sepsis KA60 Whole blood 5.07E-01 2.08E-02 1.27E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.59E-01 -1.63E-01 -7.72E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 9.78E-01 -1.02E-01 -5.84E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.27E-01 1.24E-01 7.96E-01
Olive pollen allergy CA08.00 Peripheral blood 2.29E-02 1.85E-01 1.81E+00
Oral cancer 2B6E Oral tissue 8.18E-02 -1.36E-01 -1.47E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.50E-01 4.68E-02 2.44E-01
Osteoporosis FB83.1 Bone marrow 4.21E-02 1.58E-01 9.75E-01
Ovarian cancer 2C73 Ovarian tissue 1.04E-01 -1.63E-01 -5.91E-01
Pancreatic cancer 2C10 Pancreas 6.36E-09 6.06E-01 2.06E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 6.45E-01 5.75E-03 2.48E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.79E-01 1.64E-02 1.38E-01
Pituitary cancer 2D12 Pituitary tissue 1.58E-01 1.51E-01 2.66E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.49E-02 6.49E-01 1.13E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.66E-01 -7.21E-03 -7.24E-02
Polycythemia vera 2A20.4 Whole blood 1.08E-01 -5.40E-02 -3.74E-01
Pompe disease 5C51.3 Biceps muscle 1.91E-01 -3.95E-02 -2.35E-01
Preterm birth KA21.4Z Myometrium 4.60E-01 -2.15E-02 -1.39E-01
Prostate cancer 2C82 Prostate 5.67E-01 7.23E-02 9.49E-02
Psoriasis EA90 Skin 3.29E-11 -2.38E-01 -7.16E-01
Rectal cancer 2B92 Rectal colon tissue 3.63E-03 -9.94E-01 -1.87E+00
Renal cancer 2C90-2C91 Kidney 3.97E-06 7.27E-01 2.15E+00
Retinoblastoma 2D02.2 Uvea 2.14E-01 1.02E-01 1.02E+00
Rheumatoid arthritis FA20 Synovial tissue 4.35E-01 -9.36E-02 -4.77E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.04E-03 -1.78E-01 -5.29E-01
Schizophrenia 6A20 Prefrontal cortex 5.76E-01 -1.54E-02 -6.56E-02
Schizophrenia 6A20 Superior temporal cortex 4.60E-01 4.91E-03 4.75E-02
Scleroderma 4A42.Z Whole blood 9.70E-04 3.79E-01 1.90E+00
Seizure 8A60-8A6Z Whole blood 9.75E-01 -1.02E-02 -5.48E-02
Sensitive skin EK0Z Skin 7.25E-01 0.00E+00 0.00E+00
Sepsis with septic shock 1G41 Whole blood 8.45E-11 1.36E-01 6.76E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.86E-01 1.28E-01 6.10E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.69E-01 1.18E-01 8.07E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.32E-01 1.99E-01 1.65E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.50E-01 7.87E-02 7.38E-01
Skin cancer 2C30-2C3Z Skin 1.98E-14 -2.93E-01 -8.72E-01
Thrombocythemia 3B63 Whole blood 1.14E-01 -6.71E-02 -4.83E-01
Thrombocytopenia 3B64 Whole blood 4.42E-01 2.14E-01 1.04E+00
Thyroid cancer 2D10 Thyroid 4.15E-02 4.78E-02 2.38E-01
Tibial muscular dystrophy 8C75 Muscle tissue 5.86E-01 -2.22E-02 -1.45E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.70E-02 2.04E-01 1.96E+00
Type 2 diabetes 5A11 Liver tissue 8.64E-01 1.24E-02 9.05E-02
Ureter cancer 2C92 Urothelium 9.68E-02 -1.24E-01 -5.69E-01
Uterine cancer 2C78 Endometrium tissue 4.83E-01 -9.32E-02 -1.28E-01
Vitiligo ED63.0 Skin 6.85E-01 -1.26E-01 -4.13E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Substrate specificity of purified recombinant human beta-carotene 15,15'-oxygenase (BCO1). J Biol Chem. 2013 Dec 27;288(52):37094-103.