Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE7PT32)

DME Name Alanyl aminopeptidase (ANPEP)
Synonyms Aminopeptidase M; Aminopeptidase N; CD13; Microsomal aminopeptidase; Myeloid plasma membrane glycoprotein CD13; ANPEP; AP-M; AP-N; APN; PEPN; gp150; hAPN
Gene Name ANPEP
UniProt ID
AMPN_HUMAN
INTEDE ID
DME0145
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
290
EC Number EC: 3.4.11.2
Hydrolases
Peptidase
Aminopeptidase
EC: 3.4.11.2
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNANSSPVASTTPSASATTNPA
SATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVI
IIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDS
EFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIHP
KDLTALSNMLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLLAFIVSEFDYVEKQASNGVLI
RIWARPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQIGLPDFNAGAMENWGLV
TYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYL
GADYAEPTWNLKDLMVLNDVYRVMAVDALASSHPLSTPASEINTPAQISELFDAISYSKG
ASVLRMLSSFLSEDVFKQGLASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVRDIM
NRWTLQMGFPVITVDTSTGTLSQEHFLLDPDSNVTRPSEFNYVWIVPITSIRDGRQQQDY
WLIDVRAQNDLFSTSGNEWVLLNLNVTGYYRVNYDEENWRKIQTQLQRDHSAIPVINRAQ
IINDAFNLASAHKVPVTLALNNTLFLIEERQYMPWEAALSSLSYFKLMFDRSEVYGPMKN
YLKKQVTPLFIHFRNNTNNWREIPENLMDQYSEVNAISTACSNGVPECEEMVSGLFKQWM
ENPNNNPIHPNLRSTVYCNAIAQGGEEEWDFAWEQFRNATLVNEADKLRAALACSKELWI
LNRYLSYTLNPDLIRKQDATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSN
LIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQ
WFTENSK
Function This enzyme plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases.
KEGG Pathway
Glutathione metabolism (hsa00480 )
Hematopoietic cell lineage (hsa04640 )
Metabolic pathways (hsa01100 )
Renin-angiotensin system (hsa04614 )
Reactome Pathway
Neutrophil degranulation (R-HSA-6798695 )
Metabolism of Angiotensinogen to Angiotensins (R-HSA-2022377 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Human calcitonin DM0WD1V N. A. N. A. Phase 4 [12]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.48E-01 4.26E-02 1.69E-01
Alopecia ED70 Skin from scalp 4.25E-01 -4.45E-02 -1.96E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.01E-01 2.10E-02 1.51E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.06E-01 1.31E-02 9.07E-02
Aortic stenosis BB70 Calcified aortic valve 9.79E-01 -4.07E-02 -5.38E-02
Apnea 7A40 Hyperplastic tonsil 5.57E-01 -2.23E-02 -8.35E-02
Arthropathy FA00-FA5Z Peripheral blood 1.16E-01 8.31E-02 5.39E-01
Asthma CA23 Nasal and bronchial airway 2.29E-01 -6.23E-02 -1.39E-01
Atopic dermatitis EA80 Skin 9.95E-01 2.44E-02 1.57E-01
Autism 6A02 Whole blood 9.88E-01 5.64E-02 2.34E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.86E-01 -1.39E-01 -1.26E+00
Autosomal dominant monocytopenia 4B04 Whole blood 2.24E-02 -1.19E-01 -7.00E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.62E-01 -7.69E-02 -2.53E-01
Batten disease 5C56.1 Whole blood 5.01E-02 3.14E-01 2.68E+00
Behcet's disease 4A62 Peripheral blood 2.78E-01 7.28E-02 3.76E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.70E-01 2.15E-02 1.71E-01
Bladder cancer 2C94 Bladder tissue 1.66E-03 6.45E-01 1.86E+00
Breast cancer 2C60-2C6Z Breast tissue 5.68E-05 -1.14E-02 -2.63E-02
Cardioembolic stroke 8B11.20 Whole blood 2.89E-03 2.21E-01 1.06E+00
Cervical cancer 2C77 Cervical tissue 3.41E-03 -2.64E-01 -7.25E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.34E-01 7.19E-02 2.52E-01
Chronic hepatitis C 1E51.1 Whole blood 1.90E-02 3.13E-01 1.42E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 7.64E-03 2.51E-01 9.96E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.60E-01 -4.68E-02 -2.28E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.40E-01 6.69E-02 2.39E-01
Colon cancer 2B90 Colon tissue 1.29E-01 1.64E-02 6.85E-02
Coronary artery disease BA80-BA8Z Peripheral blood 9.57E-01 2.53E-02 8.75E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.17E-01 4.27E-02 2.85E-01
Endometriosis GA10 Endometrium tissue 8.88E-01 1.42E-02 5.84E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.48E-01 -5.05E-02 -3.47E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.55E-03 -2.99E-01 -1.04E+00
Gastric cancer 2B72 Gastric tissue 6.62E-01 -9.01E-02 -2.99E-01
Glioblastopma 2A00.00 Nervous tissue 6.22E-05 6.64E-02 2.51E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.79E-01 -8.02E-02 -1.43E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.03E-06 -8.05E-01 -2.78E+00
Head and neck cancer 2D42 Head and neck tissue 4.42E-01 -1.28E-02 -5.29E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.85E-01 -6.89E-02 -4.09E-01
Huntington's disease 8A01.10 Whole blood 9.60E-01 1.78E-02 1.19E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.85E-01 -2.29E-01 -1.11E+00
Immunodeficiency 4A00-4A20 Peripheral blood 3.73E-01 2.71E-02 1.83E-01
Influenza 1E30 Whole blood 4.17E-02 2.28E-01 2.02E+00
Interstitial cystitis GC00.3 Bladder tissue 3.25E-01 6.05E-03 5.11E-02
Intracranial aneurysm 8B01.0 Intracranial artery 6.81E-01 -1.24E-03 -5.89E-03
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.09E-01 6.26E-02 1.94E-01
Ischemic stroke 8B11 Peripheral blood 3.58E-01 3.73E-03 1.88E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 1.71E-01 8.32E-02 2.51E-01
Lateral sclerosis 8B60.4 Skin 7.49E-01 2.99E-03 2.44E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 3.63E-02 1.26E-01 1.23E+00
Liver cancer 2C12.0 Liver tissue 6.50E-05 -1.45E-01 -6.33E-01
Liver failure DB99.7-DB99.8 Liver tissue 9.32E-01 -3.64E-03 -2.89E-02
Lung cancer 2C25 Lung tissue 1.83E-03 -6.13E-02 -3.22E-01
Lupus erythematosus 4A40 Whole blood 3.69E-02 -5.43E-02 -1.83E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.18E-01 2.91E-03 2.60E-02
Major depressive disorder 6A70-6A7Z Whole blood 8.67E-01 -2.23E-04 -8.28E-04
Melanoma 2C30 Skin 7.26E-01 1.51E-01 2.44E-01
Multiple myeloma 2A83.1 Peripheral blood 7.17E-01 -9.07E-02 -5.19E-01
Multiple myeloma 2A83.1 Bone marrow 7.52E-03 -2.76E-01 -1.89E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.82E-01 8.85E-02 3.71E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.88E-01 3.55E-02 1.67E-01
Myelofibrosis 2A20.2 Whole blood 1.89E-01 -3.74E-02 -4.29E-01
Myocardial infarction BA41-BA50 Peripheral blood 6.33E-01 1.02E-01 3.37E-01
Myopathy 8C70.6 Muscle tissue 4.00E-01 -1.08E-01 -1.14E+00
Neonatal sepsis KA60 Whole blood 1.47E-02 -8.30E-02 -3.61E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.36E-03 -5.67E-01 -1.80E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 7.96E-01 2.73E-02 2.62E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.97E-01 -6.64E-03 -6.71E-02
Olive pollen allergy CA08.00 Peripheral blood 4.00E-01 -4.50E-02 -5.08E-01
Oral cancer 2B6E Oral tissue 1.71E-02 -3.13E-01 -8.52E-01
Osteoarthritis FA00-FA0Z Synovial tissue 7.93E-01 -1.13E-01 -2.60E-01
Osteoporosis FB83.1 Bone marrow 1.14E-02 6.37E-02 1.19E+00
Ovarian cancer 2C73 Ovarian tissue 3.08E-01 -2.81E-01 -5.60E-01
Pancreatic cancer 2C10 Pancreas 1.66E-03 -3.53E-01 -9.30E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.33E-01 -5.11E-02 -3.14E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.24E-01 -3.30E-02 -1.95E-01
Pituitary cancer 2D12 Pituitary tissue 1.52E-01 6.09E-02 2.30E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.36E-01 2.19E-02 6.98E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.77E-01 7.16E-02 4.35E-01
Polycythemia vera 2A20.4 Whole blood 5.55E-01 5.84E-02 5.11E-01
Pompe disease 5C51.3 Biceps muscle 4.11E-02 -1.89E-01 -1.03E+00
Preterm birth KA21.4Z Myometrium 2.64E-01 -1.65E-01 -7.80E-01
Prostate cancer 2C82 Prostate 2.04E-02 1.19E-01 3.36E-01
Psoriasis EA90 Skin 8.84E-07 -3.04E-01 -7.15E-01
Rectal cancer 2B92 Rectal colon tissue 9.54E-01 3.53E-02 1.83E-01
Renal cancer 2C90-2C91 Kidney 1.23E-01 -1.22E-01 -4.62E-01
Retinoblastoma 2D02.2 Uvea 9.69E-01 -3.16E-02 -3.60E-01
Rheumatoid arthritis FA20 Synovial tissue 7.36E-01 -4.18E-02 -9.52E-02
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.88E-01 6.05E-04 4.22E-03
Schizophrenia 6A20 Prefrontal cortex 7.11E-01 9.38E-03 4.58E-02
Schizophrenia 6A20 Superior temporal cortex 8.22E-01 4.19E-02 3.33E-01
Scleroderma 4A42.Z Whole blood 1.76E-01 -2.59E-02 -2.01E-01
Seizure 8A60-8A6Z Whole blood 3.74E-01 -1.01E-01 -6.44E-01
Sensitive skin EK0Z Skin 8.63E-01 -5.44E-02 -3.39E-01
Sepsis with septic shock 1G41 Whole blood 5.53E-01 7.45E-03 3.03E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.15E-01 3.20E-01 7.51E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.10E-01 5.24E-02 3.63E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.71E-01 1.84E-02 3.12E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.45E-01 -3.01E-01 -1.01E+00
Skin cancer 2C30-2C3Z Skin 7.62E-04 -1.71E-01 -4.36E-01
Thrombocythemia 3B63 Whole blood 2.22E-01 -1.82E-02 -1.91E-01
Thrombocytopenia 3B64 Whole blood 2.76E-02 2.56E-01 1.84E+00
Thyroid cancer 2D10 Thyroid 5.39E-03 9.77E-02 3.16E-01
Tibial muscular dystrophy 8C75 Muscle tissue 6.94E-02 -4.28E-02 -2.29E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.84E-01 8.82E-02 4.86E-01
Type 2 diabetes 5A11 Liver tissue 7.24E-01 3.89E-02 3.39E-01
Ureter cancer 2C92 Urothelium 8.84E-01 2.85E-02 1.10E-01
Uterine cancer 2C78 Endometrium tissue 1.03E-13 -2.31E-01 -7.62E-01
Vitiligo ED63.0 Skin 1.67E-01 -4.67E-02 -3.02E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Aminopeptidase N (ANPEP) DTT Info
DME DTT Type Clinical trial
1 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
IP10 C8 DMANRGW Psoriasis vulgaris EA90 Phase 2 [1]
39 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(1-Amino-2-phenyl-ethyl)-phosphinic acid DMXD8H1 Discovery agent N.A. Investigative [2]
(1-Amino-3-methyl-butyl)-phosphinic acid DMNUO79 Discovery agent N.A. Investigative [2]
(1-Amino-3-methylsulfanyl-propyl)-phosphinic acid DMJL8QZ Discovery agent N.A. Investigative [2]
(1-Amino-3-phenyl-propyl)-phosphinic acid DMXD697 Discovery agent N.A. Investigative [2]
(1-Amino-ethyl)-phosphinic acid DMUACZF Discovery agent N.A. Investigative [2]
(Amino-phenyl-methyl)-phosphinic acid DMS4ZVK Discovery agent N.A. Investigative [2]
(S)-2-Amino-2-phenyl-ethanethiol DMFEGPX Discovery agent N.A. Investigative [2]
(S)-2-Amino-3-phenyl-propane-1-thiol DMMAUKO Discovery agent N.A. Investigative [2]
(S)-2-Amino-4-methyl-pentane-1-thiol DM96XYI Discovery agent N.A. Investigative [2]
(S)-2-Amino-4-methylsulfanyl-butane-1-thiol DMOVQ1T Discovery agent N.A. Investigative [2]
(S)-2-Amino-4-phenyl-butane-1-thiol DMJEGMI Discovery agent N.A. Investigative [2]
(S)-2-Amino-propane-1-thiol DMYG8EV Discovery agent N.A. Investigative [2]
1-aminobutylphosphonic acid DM4TFN6 Discovery agent N.A. Investigative [3]
1-aminohexylphosphonic acid DMFUABI Discovery agent N.A. Investigative [3]
1-aminohexylphosphonic acid monophenyl ester DML6UJM Discovery agent N.A. Investigative [3]
1-aminopentylphosphonic acid monophenyl ester DMMV30B Discovery agent N.A. Investigative [3]
2-amino-N1-benzyl-N3-hydroxymalonamide DMQ30UY Discovery agent N.A. Investigative [4]
2-benzyl-N1-hydroxy-N3-(3-phenylpropyl)malonamide DMF5MGQ Discovery agent N.A. Investigative [4]
2-benzyl-N1-hydroxy-N3-(4-phenylbutyl)malonamide DMRVA94 Discovery agent N.A. Investigative [4]
2-benzyl-N1-hydroxy-N3-phenethylmalonamide DM2BPIN Discovery agent N.A. Investigative [4]
2-Cinnamamido-N1-hydroxy-N4-octylsuccinamide DMXYTGU Discovery agent N.A. Investigative [5]
2-Cinnamamido-N1-hydroxy-N4-pentylsuccinamide DMI6FZN Discovery agent N.A. Investigative [5]
2-Cinnamamido-N4-hexyl-N1-hydroxysuccinamide DMRNGK7 Discovery agent N.A. Investigative [5]
Angiotensin IV DMR9OD1 Discovery agent N.A. Investigative [6]
KELATORPHAN DMOX8FD Discovery agent N.A. Investigative [7]
N-biphenyl-3-ylmethyl-N'-hydroxy-malonamide DMJF9VA Discovery agent N.A. Investigative [4]
N-Hydroxy-2-(naphthalen-2-ylsulfanyl)-acetamide DMISXUM Discovery agent N.A. Investigative [8]
N1,2-dibenzyl-N3-hydroxy-N1-phenethylmalonamide DM1L89K Discovery agent N.A. Investigative [4]
N1,2-dibenzyl-N3-hydroxymalonamide DMM59IS Discovery agent N.A. Investigative [4]
N1-(3,3-diphenylpropyl)-N3-hydroxymalonamide DM5F04D Discovery agent N.A. Investigative [4]
N1-(3-phenoxybenzyl)-N3-hydroxymalonamide DMSRHJA Discovery agent N.A. Investigative [4]
N1-(4-chlorobenzyl)-2-amino-N3-hydroxymalonamide DMJ025O Discovery agent N.A. Investigative [4]
N1-(4-chlorobenzyl)-2-benzyl-N3-hydroxymalonamide DMTMDZ4 Discovery agent N.A. Investigative [4]
N1-(4-fluorobenzyl)-2-benzyl-N3-hydroxymalonamide DMS1P85 Discovery agent N.A. Investigative [4]
N1-benzyl-N3-hydroxy-2-isobutylmalonamide DMXSFWK Discovery agent N.A. Investigative [9]
N1-hydroxy-2-isobutyl-N3-phenethylmalonamide DMF6RVS Discovery agent N.A. Investigative [9]
N4-Butyl-2-cinnamamido-N1-hydroxysuccinamide DM1N73J Discovery agent N.A. Investigative [5]
PMID23428964CI3 DMZUQ7X Discovery agent N.A. Investigative [10]
[(125)I] RB129 DMX0G7E Discovery agent N.A. Investigative [11]
⏷ Show the Full List of 39 Investigative Drug(s)

References

1 Recent insights into the role of dipeptidyl aminopeptidase IV (DPIV) and aminopeptidase N (APN) families in immune functions. Clin Chem Lab Med. 2009;47(3):253-61.
2 Design of the first highly potent and selective aminopeptidase N (EC 3.4.11.2) inhibitor. Bioorg Med Chem Lett. 1999 Jun 7;9(11):1511-6.
3 New aromatic monoesters of alpha-aminoaralkylphosphonic acids as inhibitors of aminopeptidase N/CD13. Bioorg Med Chem. 2010 Apr 15;18(8):2930-6.
4 Novel selective inhibitors of the zinc plasmodial aminopeptidase PfA-M1 as potential antimalarial agents. J Med Chem. 2007 Mar 22;50(6):1322-34.
5 Design, synthesis, and preliminary studies of the activity of novel derivatives of N-cinnamoyl-L-aspartic acid as inhibitors of aminopeptidase N/CD13. Bioorg Med Chem. 2009 Oct 15;17(20):7398-404.
6 Ligands to the (IRAP)/AT4 receptor encompassing a 4-hydroxydiphenylmethane scaffold replacing Tyr2. Bioorg Med Chem. 2008 Jul 15;16(14):6924-35.
7 Retro-inverso concept applied to the complete inhibitors of enkephalin-degrading enzymes. J Med Chem. 1988 Sep;31(9):1825-31.
8 N-hydroxy-2-(naphthalene-2-ylsulfanyl)-acetamide, a novel hydroxamic acid-based inhibitor of aminopeptidase N and its anti-angiogenic activity. Bioorg Med Chem Lett. 2005 Jan 3;15(1):181-3.
9 A library of novel hydroxamic acids targeting the metallo-protease family: design, parallel synthesis and screening. Bioorg Med Chem. 2007 Jan 1;15(1):63-76.
10 Selective aminopeptidase-N (CD13) inhibitors with relevance to cancer chemotherapy. Bioorg Med Chem. 2013 Apr 1;21(7):2135-44.
11 Ontogenic and adult whole body distribution of aminopeptidase N in rat investigated by in vitro autoradiography. Biochimie. 2004 Feb;86(2):105-13.
12 Renal metabolism of calcitonin. Am J Physiol. 1988 Apr;254(4 Pt 2):F593-600.