Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE8451N)

DME Name Glucosamine-6-phosphate deaminase 1 (GNPDA1)
Synonyms Glucosamine-6-phosphate isomerase 1; GlcN6P deaminase 1; GNPDA 1; GNPDA1; GNPI; HLN; KIAA0060; Oscillin
Gene Name GNPDA1
UniProt ID
GNPI1_HUMAN
INTEDE ID
DME0521
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
10007
EC Number EC: 3.5.99.6
Hydrolases
Carbon-nitrogen hydrolase
Carbon-nitrogen hydrolase
EC: 3.5.99.6
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MKLIILEHYSQASEWAAKYIRNRIIQFNPGPEKYFTLGLPTGSTPLGCYKKLIEYYKNGD
LSFKYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENTHILDGNAVDLQAECDA
FEEKIKAAGGIELFVGGIGPDGHIAFNEPGSSLVSRTRVKTLAMDTILANARFFDGELTK
VPTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTVFVCD
EDATLELKVKTVKYFKGLMLVHNKLVDPLYSIKEKETEKSQSSKKPYSD
Function This enzyme is an allosteric enzyme that catalyzes the reversible conversion of D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium.
KEGG Pathway
Amino sugar and nucleotide sugar metabolism (hsa00520 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Glycolysis (R-HSA-70171 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
D-glucosamine-phosphate DMPMYTE N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.94E-07 -2.75E-01 -5.35E-01
Alopecia ED70 Skin from scalp 4.01E-02 6.31E-02 2.51E-01
Alzheimer's disease 8A20 Entorhinal cortex 7.76E-02 -3.84E-02 -2.27E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.05E-01 9.89E-02 2.79E-01
Aortic stenosis BB70 Calcified aortic valve 9.86E-01 -2.19E-01 -1.77E-01
Apnea 7A40 Hyperplastic tonsil 7.51E-02 -1.89E-01 -5.17E-01
Arthropathy FA00-FA5Z Peripheral blood 6.16E-02 -1.59E-01 -7.23E-01
Asthma CA23 Nasal and bronchial airway 7.56E-05 2.20E-01 2.08E-01
Atopic dermatitis EA80 Skin 8.06E-01 3.60E-02 1.54E-01
Autism 6A02 Whole blood 6.00E-01 -7.28E-02 -3.44E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.16E-01 6.45E-01 1.59E+00
Autosomal dominant monocytopenia 4B04 Whole blood 3.77E-02 1.83E+00 1.39E+00
Bacterial infection of gingival 1C1H Gingival tissue 2.30E-01 4.80E-02 1.87E-01
Batten disease 5C56.1 Whole blood 9.57E-02 6.89E-02 5.07E-01
Behcet's disease 4A62 Peripheral blood 6.78E-01 -1.65E-02 -7.42E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.25E-01 -5.86E-03 -2.41E-02
Bladder cancer 2C94 Bladder tissue 5.28E-04 -8.83E-01 -2.76E+00
Breast cancer 2C60-2C6Z Breast tissue 7.74E-19 1.79E-01 3.86E-01
Cardioembolic stroke 8B11.20 Whole blood 2.71E-09 5.33E-01 1.95E+00
Cervical cancer 2C77 Cervical tissue 7.80E-02 1.84E-01 5.55E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.68E-01 -3.66E-02 -6.97E-02
Chronic hepatitis C 1E51.1 Whole blood 7.79E-01 -6.95E-02 -1.44E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.85E-01 -3.91E-02 -1.14E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.53E-01 -2.80E-02 -6.45E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.15E-01 5.66E-02 2.30E-01
Colon cancer 2B90 Colon tissue 1.48E-70 8.61E-01 2.20E+00
Coronary artery disease BA80-BA8Z Peripheral blood 6.00E-01 1.08E-01 1.30E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.46E-01 1.93E-01 3.55E-01
Endometriosis GA10 Endometrium tissue 5.87E-01 2.52E-02 4.37E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.52E-02 1.06E-01 6.45E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.49E-07 7.30E-01 1.92E+00
Gastric cancer 2B72 Gastric tissue 1.21E-02 7.65E-01 4.83E+00
Glioblastopma 2A00.00 Nervous tissue 1.21E-18 1.30E-01 4.31E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.31E-01 -1.83E-01 -4.08E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.13E-01 7.96E-01 9.46E-01
Head and neck cancer 2D42 Head and neck tissue 3.50E-22 4.01E-01 1.46E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.66E-01 -6.62E-02 -1.87E-01
Huntington's disease 8A01.10 Whole blood 4.02E-01 -2.06E-01 -6.53E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.02E-01 1.34E-01 2.85E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.79E-01 1.63E-01 1.20E+00
Influenza 1E30 Whole blood 5.70E-02 -8.64E-01 -2.20E+00
Interstitial cystitis GC00.3 Bladder tissue 1.93E-04 -6.52E-01 -2.99E+00
Intracranial aneurysm 8B01.0 Intracranial artery 5.35E-03 8.99E-01 2.26E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.20E-02 -2.34E-02 -1.05E-01
Ischemic stroke 8B11 Peripheral blood 1.30E-01 -1.56E-01 -5.14E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.78E-03 1.32E-01 4.94E-01
Lateral sclerosis 8B60.4 Skin 7.68E-01 -4.63E-03 -5.38E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 6.59E-01 2.75E-02 3.10E-02
Liver cancer 2C12.0 Liver tissue 7.50E-10 4.20E-01 9.74E-01
Liver failure DB99.7-DB99.8 Liver tissue 7.48E-07 1.40E+00 4.15E+00
Lung cancer 2C25 Lung tissue 2.36E-18 2.92E-01 8.49E-01
Lupus erythematosus 4A40 Whole blood 1.22E-04 1.97E-01 4.14E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.83E-01 -5.42E-02 -2.41E-01
Major depressive disorder 6A70-6A7Z Whole blood 6.98E-01 4.12E-04 1.37E-03
Melanoma 2C30 Skin 2.91E-03 6.10E-01 8.86E-01
Multiple myeloma 2A83.1 Peripheral blood 7.80E-01 2.71E-01 5.35E-01
Multiple myeloma 2A83.1 Bone marrow 2.70E-01 2.83E-01 6.15E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.20E-01 -1.79E-01 -4.95E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 6.01E-09 1.68E+00 1.95E+00
Myelofibrosis 2A20.2 Whole blood 5.82E-01 1.31E-02 7.50E-02
Myocardial infarction BA41-BA50 Peripheral blood 2.92E-03 -1.98E-01 -3.16E-01
Myopathy 8C70.6 Muscle tissue 1.61E-02 3.28E-01 1.24E+00
Neonatal sepsis KA60 Whole blood 2.88E-06 2.87E-01 8.07E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.63E-04 4.68E-01 1.35E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.59E-01 6.01E-02 2.16E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.47E-01 -1.94E-01 -3.43E-01
Olive pollen allergy CA08.00 Peripheral blood 1.40E-01 6.47E-01 1.19E+00
Oral cancer 2B6E Oral tissue 2.45E-05 4.45E-01 9.93E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.69E-01 1.42E-01 5.62E-01
Osteoporosis FB83.1 Bone marrow 2.91E-01 -1.59E-01 -3.01E-01
Ovarian cancer 2C73 Ovarian tissue 4.12E-01 8.41E-03 3.69E-02
Pancreatic cancer 2C10 Pancreas 6.44E-04 3.33E-01 7.87E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.55E-01 1.19E-01 3.17E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.26E-04 2.58E-01 1.04E+00
Pituitary cancer 2D12 Pituitary tissue 1.22E-01 8.99E-02 2.39E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 9.67E-01 -5.09E-02 -1.77E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.73E-01 1.46E-02 1.25E-01
Polycythemia vera 2A20.4 Whole blood 5.96E-01 -4.48E-03 -2.90E-02
Pompe disease 5C51.3 Biceps muscle 1.75E-07 1.24E+00 5.46E+00
Preterm birth KA21.4Z Myometrium 8.03E-01 -3.79E-02 -3.06E-01
Prostate cancer 2C82 Prostate 4.98E-04 -3.84E-01 -8.21E-01
Psoriasis EA90 Skin 5.64E-05 1.50E-01 5.92E-01
Rectal cancer 2B92 Rectal colon tissue 6.90E-06 4.05E-01 3.61E+00
Renal cancer 2C90-2C91 Kidney 7.77E-01 7.60E-02 1.80E-01
Retinoblastoma 2D02.2 Uvea 2.94E-14 1.92E+00 7.87E+00
Rheumatoid arthritis FA20 Synovial tissue 1.15E-01 2.67E-01 3.82E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.35E-02 9.35E-02 4.40E-01
Schizophrenia 6A20 Prefrontal cortex 2.74E-01 -3.39E-02 -1.60E-01
Schizophrenia 6A20 Superior temporal cortex 6.73E-01 -6.18E-02 -3.75E-01
Scleroderma 4A42.Z Whole blood 2.15E-01 -8.62E-02 -7.63E-01
Seizure 8A60-8A6Z Whole blood 7.36E-02 -8.69E-02 -3.57E-01
Sensitive skin EK0Z Skin 7.70E-02 1.04E-01 1.44E+00
Sepsis with septic shock 1G41 Whole blood 8.85E-06 1.27E-01 4.08E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.92E-01 7.18E-02 2.60E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.29E-03 -5.91E-01 -6.30E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.45E-01 -1.13E-02 -2.22E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.87E-03 8.29E-01 4.02E+00
Skin cancer 2C30-2C3Z Skin 4.30E-55 7.92E-01 2.74E+00
Thrombocythemia 3B63 Whole blood 2.67E-01 3.81E-02 2.17E-01
Thrombocytopenia 3B64 Whole blood 3.60E-01 4.42E-01 1.36E+00
Thyroid cancer 2D10 Thyroid 5.18E-34 4.79E-01 2.07E+00
Tibial muscular dystrophy 8C75 Muscle tissue 8.48E-01 1.23E-03 7.08E-03
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.49E-01 -2.68E-01 -2.55E+00
Type 2 diabetes 5A11 Liver tissue 4.71E-01 3.46E-01 1.65E+00
Ureter cancer 2C92 Urothelium 2.27E-01 2.69E-02 1.17E-01
Uterine cancer 2C78 Endometrium tissue 6.88E-11 3.30E-01 7.70E-01
Vitiligo ED63.0 Skin 3.72E-01 -5.82E-02 -2.06E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Allosteric kinetics of the isoform 1 of human glucosamine-6-phosphate deaminase. Biochim Biophys Acta. 2011 Dec;1814(12):1846-53.