Details of Drug-Metabolizing Enzyme (DME)
General Information of Drug-Metabolizing Enzyme (DME) (ID: DE84PFW)
DME Name | Cardiac glycoside reductase 1 (cgr1) | ||||
---|---|---|---|---|---|
Synonyms | Cardiac glycoside reductase operon protein 1; Cytochrome c-type protein Cgr1; cgr1 | ||||
Gene Name | cgr1 | ||||
UniProt ID | |||||
INTEDE ID | |||||
3D Structure | |||||
Gene ID | |||||
EC Number | EC: 1.3.2.- | ||||
Lineage | Species: Eggerthella lenta | ||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MAEEPVVIGDPAPRTRKWPIVVGVVVVVLIAAGAGFWVWHEQPSFCAAICHTPMDEYLET
YEQEAGTAGVDKWGNEVANTNAMLAVSHKAQGKDCMACHVPTLSEQMSEGMNWVTGNYVY PLEERDTEMLTEARGVDADEFCLNESCHNLTRDDLIKATSDMEFNPHQPQHGEIECSECH KAHRASVMYCTQCHSEAEVPEGWLTVAEANKLSTAA |
||||
Function | This enzyme anchors as a dimer in the cytoplasmic membrane and shuttles quinone derived electrons to associated periplasmic nitrite reductases. | ||||
Molecular Interaction Atlas (MIA) of This DME
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Approved Drug(s) Metabolized by This DME
|
||||||||||||||||||||||||||||