Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE8E6X9)

DME Name Soluble aminopeptidase P (sAmp)
Synonyms Aminoacylproline aminopeptidase; Cytosolic aminopeptidase P; X-Pro aminopeptidase 1; Soluble X-prolyl aminopeptidase 1; Xaa-Pro aminopeptidase 1; sAmp; XPNPEP1; XPNPEPL; XPNPEPL1
Gene Name XPNPEP1
UniProt ID
XPP1_HUMAN
INTEDE ID
DME0501
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
7511
EC Number EC: 3.4.11.9
Hydrolases
Peptidase
Aminopeptidase
EC: 3.4.11.9
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MPPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSA
GTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVD
PLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKD
KVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGD
RIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSE
TIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEI
SAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQY
KDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSG
LDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVV
LVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKEL
QKQGRQEALEWLIRETQPISKQH
Function This enzyme contributes to the degradation of bradykinin. It catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro.

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
BRADYKININ DM4R6UV N. A. N. A. Phase 1 [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
BRADYKININ N. A. Phase 1 Km = 0.101 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.62E-29 7.95E-01 1.34E+00
Alopecia ED70 Skin from scalp 4.16E-01 -1.33E-01 -3.54E-01
Alzheimer's disease 8A20 Entorhinal cortex 6.51E-04 -1.27E-01 -5.35E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.31E-02 3.67E-01 1.18E+00
Aortic stenosis BB70 Calcified aortic valve 9.77E-01 5.81E-02 2.14E-01
Apnea 7A40 Hyperplastic tonsil 2.49E-01 -1.12E-01 -5.98E-01
Arthropathy FA00-FA5Z Peripheral blood 6.98E-01 2.61E-03 1.22E-02
Asthma CA23 Nasal and bronchial airway 2.95E-02 1.83E-01 3.29E-01
Atopic dermatitis EA80 Skin 1.14E-04 -3.95E-01 -1.13E+00
Autism 6A02 Whole blood 8.59E-01 -2.96E-02 -6.10E-02
Autoimmune uveitis 9A96 Peripheral monocyte 7.57E-01 -6.38E-02 -2.00E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.90E-02 3.43E-01 2.41E+00
Bacterial infection of gingival 1C1H Gingival tissue 7.39E-01 2.49E-02 8.12E-02
Batten disease 5C56.1 Whole blood 8.59E-01 2.86E-01 5.15E-01
Behcet's disease 4A62 Peripheral blood 7.86E-01 -7.94E-02 -2.31E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.99E-01 7.46E-03 4.38E-02
Bladder cancer 2C94 Bladder tissue 3.05E-05 -6.03E-01 -2.63E+00
Breast cancer 2C60-2C6Z Breast tissue 6.17E-10 2.32E-01 4.91E-01
Cardioembolic stroke 8B11.20 Whole blood 1.74E-01 8.60E-02 4.22E-01
Cervical cancer 2C77 Cervical tissue 4.05E-01 9.40E-02 2.87E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.49E-01 1.23E-01 9.48E-02
Chronic hepatitis C 1E51.1 Whole blood 1.07E-01 -1.01E-01 -4.97E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.73E-01 6.27E-02 1.47E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.75E-03 -3.14E-01 -7.20E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.18E-02 3.13E-01 1.34E+00
Colon cancer 2B90 Colon tissue 2.25E-23 -3.32E-01 -8.66E-01
Coronary artery disease BA80-BA8Z Peripheral blood 1.08E-01 1.19E-01 5.63E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.54E-01 6.64E-01 8.42E-01
Endometriosis GA10 Endometrium tissue 2.02E-03 -4.03E-01 -1.01E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.61E-02 -1.36E-01 -5.46E-01
Familial hypercholesterolemia 5C80.00 Whole blood 9.16E-08 1.07E+00 1.53E+00
Gastric cancer 2B72 Gastric tissue 3.51E-01 3.45E-01 4.04E-01
Glioblastopma 2A00.00 Nervous tissue 6.11E-02 -8.81E-02 -1.40E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 9.85E-02 6.76E-01 3.04E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 9.41E-01 -1.03E-01 -3.14E-01
Head and neck cancer 2D42 Head and neck tissue 7.56E-01 1.52E-02 2.83E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.43E-01 6.38E-02 2.29E-01
Huntington's disease 8A01.10 Whole blood 4.70E-02 2.61E-01 7.44E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.73E-01 3.25E-02 1.49E-01
Immunodeficiency 4A00-4A20 Peripheral blood 9.96E-01 -1.49E-01 -4.50E-01
Influenza 1E30 Whole blood 1.76E-02 -4.48E-01 -6.10E+00
Interstitial cystitis GC00.3 Bladder tissue 2.90E-02 2.91E-01 1.74E+00
Intracranial aneurysm 8B01.0 Intracranial artery 9.33E-04 9.78E-01 1.87E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.85E-01 -8.66E-03 -3.61E-02
Ischemic stroke 8B11 Peripheral blood 5.04E-01 -4.28E-02 -1.61E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 7.94E-01 8.02E-02 1.40E-01
Lateral sclerosis 8B60.4 Skin 1.22E-01 -1.17E-01 -2.42E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 3.01E-01 1.36E-01 3.93E-01
Liver cancer 2C12.0 Liver tissue 2.89E-02 2.52E-01 4.38E-01
Liver failure DB99.7-DB99.8 Liver tissue 4.02E-01 2.38E-01 7.43E-01
Lung cancer 2C25 Lung tissue 9.93E-04 -1.46E-01 -4.08E-01
Lupus erythematosus 4A40 Whole blood 5.84E-04 2.29E-01 5.06E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.60E-01 6.89E-02 4.39E-01
Major depressive disorder 6A70-6A7Z Whole blood 6.00E-01 -3.17E-02 -1.41E-01
Melanoma 2C30 Skin 1.00E-01 4.35E-01 4.11E-01
Multiple myeloma 2A83.1 Peripheral blood 9.65E-01 -6.92E-02 -1.66E-01
Multiple myeloma 2A83.1 Bone marrow 3.69E-03 1.63E-01 9.05E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.21E-02 3.06E-01 1.02E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.67E-04 -2.57E-01 -9.45E-01
Myelofibrosis 2A20.2 Whole blood 2.07E-06 -1.12E-01 -8.09E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.80E-01 -4.40E-01 -6.14E-01
Myopathy 8C70.6 Muscle tissue 6.91E-02 2.63E-01 4.34E-01
Neonatal sepsis KA60 Whole blood 1.11E-07 3.02E-01 7.85E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.66E-04 1.08E+00 1.89E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.96E-01 1.18E-01 2.50E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.26E-02 -1.54E-01 -1.29E+00
Olive pollen allergy CA08.00 Peripheral blood 4.67E-01 4.75E-02 9.61E-02
Oral cancer 2B6E Oral tissue 1.03E-07 9.27E-01 1.69E+00
Osteoarthritis FA00-FA0Z Synovial tissue 5.38E-01 2.17E-02 2.19E-02
Osteoporosis FB83.1 Bone marrow 3.82E-01 3.07E-01 1.79E+00
Ovarian cancer 2C73 Ovarian tissue 8.13E-03 6.21E-01 1.19E+00
Pancreatic cancer 2C10 Pancreas 2.34E-01 4.16E-01 5.79E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 7.15E-01 -1.08E-01 -2.85E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.08E-04 3.40E-01 1.55E+00
Pituitary cancer 2D12 Pituitary tissue 4.52E-01 -2.40E-01 -4.81E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.42E-02 -3.13E-01 -1.11E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.54E-01 4.70E-02 2.69E-01
Polycythemia vera 2A20.4 Whole blood 5.19E-18 -3.93E-01 -2.05E+00
Pompe disease 5C51.3 Biceps muscle 8.73E-01 -6.30E-02 -3.76E-01
Preterm birth KA21.4Z Myometrium 5.35E-01 -4.28E-01 -5.15E-01
Prostate cancer 2C82 Prostate 2.15E-03 -5.10E-01 -6.14E-01
Psoriasis EA90 Skin 5.31E-09 -1.64E-01 -4.22E-01
Rectal cancer 2B92 Rectal colon tissue 1.33E-03 -3.65E-01 -1.97E+00
Renal cancer 2C90-2C91 Kidney 5.03E-02 3.15E-01 4.70E-01
Retinoblastoma 2D02.2 Uvea 1.48E-04 7.05E-01 3.05E+00
Rheumatoid arthritis FA20 Synovial tissue 4.97E-08 1.63E+00 4.94E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.72E-01 2.15E-03 1.13E-02
Schizophrenia 6A20 Prefrontal cortex 4.01E-01 -2.99E-03 -7.73E-03
Schizophrenia 6A20 Superior temporal cortex 7.86E-01 -9.46E-02 -4.14E-01
Scleroderma 4A42.Z Whole blood 1.93E-04 -4.94E-01 -2.02E+00
Seizure 8A60-8A6Z Whole blood 1.84E-02 -3.42E-01 -1.45E+00
Sensitive skin EK0Z Skin 8.01E-01 -2.03E-02 -1.64E-01
Sepsis with septic shock 1G41 Whole blood 1.02E-03 -1.73E-01 -4.78E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.16E-01 -4.01E-01 -8.48E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.88E-03 4.53E-01 9.72E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.00E-01 8.79E-02 1.80E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.44E-01 1.65E-01 2.04E+00
Skin cancer 2C30-2C3Z Skin 9.12E-01 -1.65E-01 -2.98E-01
Thrombocythemia 3B63 Whole blood 1.05E-12 -3.65E-01 -2.35E+00
Thrombocytopenia 3B64 Whole blood 7.11E-01 -1.59E-01 -3.33E-01
Thyroid cancer 2D10 Thyroid 4.73E-01 -5.74E-02 -1.47E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.42E-01 3.49E-01 9.38E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.75E-03 -5.31E-01 -2.99E+00
Type 2 diabetes 5A11 Liver tissue 1.37E-01 -1.86E-01 -5.49E-01
Ureter cancer 2C92 Urothelium 2.61E-01 -1.23E-01 -4.92E-01
Uterine cancer 2C78 Endometrium tissue 6.52E-05 -2.65E-01 -4.59E-01
Vitiligo ED63.0 Skin 3.66E-01 6.20E-02 3.51E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Cloning, expression, and characterization of human cytosolic aminopeptidase P: a single manganese(II)-dependent enzyme. Biochemistry. 2000 Dec 12;39(49):15121-8.