Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE8LBNO)

DME Name Poly [ADP-ribose] polymerase 3 (PARP3)
Synonyms
ADP-ribosyltransferase diphtheria toxin-like 3; DNA ADP-ribosyltransferase PARP3; NAD(+) ADP-ribosyltransferase 3; Poly[ADP-ribose] synthase 3; Protein mono-ADP-ribosyltransferase PARP3; hPARP-3; pADPRT-3; ADPRT-3; ADPRT3; ADPRTL3; ARTD3; IRT1; PARP-3; PARP3
Gene Name PARP3
UniProt ID
PARP3_HUMAN
INTEDE ID
DME0594
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
10039
EC Number EC: 2.4.2.30
Transferase
Glycosyltransferases
Pentosyltransferase
EC: 2.4.2.30
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAPKPKPWVQTEGPEKKKGRQAGREEDPFRSTAEALKAIPAEKRIIRVDPTCPLSSNPGT
QVYEDYNCTLNQTNIENNNNKFYIIQLLQDSNRFFTCWNRWGRVGEVGQSKINHFTRLED
AKKDFEKKFREKTKNNWAERDHFVSHPGKYTLIEVQAEDEAQEAVVKVDRGPVRTVTKRV
QPCSLDPATQKLITNIFSKEMFKNTMALMDLDVKKMPLGKLSKQQIARGFEALEALEEAL
KGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQAKKDMLLVLADIELAQALQA
VSEQEKTVEEVPHPLDRDYQLLKCQLQLLDSGAPEYKVIQTYLEQTGSNHRCPTLQHIWK
VNQEGEEDRFQAHSKLGNRKLLWHGTNMAVVAAILTSGLRIMPHSGGRVGKGIYFASENS
KSAGYVIGMKCGAHHVGYMFLGEVALGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPT
QDTELELDGQQVVVPQGQPVPCPEFSSSTFSQSEYLIYQESQCRLRYLLEVHL
Function
This enzyme mediates mono-ADP- ribosylation of target proteins and plays a key role in the response to DNA damage. It mediates mono-ADP- ribosylation of glutamate, aspartate or lysine residues on target proteins. In contrast to PARP1 and PARP2, it is not able to mediate poly-ADP-ribosylation.
KEGG Pathway
Apoptosis (hsa04210 )
Base excision repair (hsa03410 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
agmatine DMSBZ29 Discovery agent N.A. Investigative [3]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.27E-09 2.28E-01 7.85E-01
Alopecia ED70 Skin from scalp 2.82E-02 2.21E-01 5.84E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.35E-01 -1.09E-02 -5.65E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 9.82E-01 -5.85E-02 -2.75E-01
Aortic stenosis BB70 Calcified aortic valve 9.53E-01 -1.64E-02 -4.55E-02
Apnea 7A40 Hyperplastic tonsil 3.14E-01 2.74E-01 1.33E+00
Arthropathy FA00-FA5Z Peripheral blood 9.54E-01 -2.32E-04 -1.69E-03
Asthma CA23 Nasal and bronchial airway 5.22E-02 1.67E-02 3.34E-02
Atopic dermatitis EA80 Skin 6.82E-03 1.05E-01 5.81E-01
Autism 6A02 Whole blood 5.26E-02 -1.29E-01 -5.50E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.48E-01 4.17E-03 2.68E-02
Autosomal dominant monocytopenia 4B04 Whole blood 3.08E-02 4.14E-01 1.46E+00
Bacterial infection of gingival 1C1H Gingival tissue 5.73E-05 2.34E-01 7.70E-01
Batten disease 5C56.1 Whole blood 3.32E-01 9.71E-02 5.94E-01
Behcet's disease 4A62 Peripheral blood 8.32E-01 1.30E-02 8.38E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.51E-01 3.41E-02 1.80E-01
Bladder cancer 2C94 Bladder tissue 5.90E-03 -3.23E-01 -1.40E+00
Breast cancer 2C60-2C6Z Breast tissue 1.84E-26 -2.95E-01 -7.68E-01
Cardioembolic stroke 8B11.20 Whole blood 5.49E-01 -2.84E-02 -1.44E-01
Cervical cancer 2C77 Cervical tissue 7.22E-01 1.19E-02 3.87E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.47E-02 1.34E-01 5.80E-01
Chronic hepatitis C 1E51.1 Whole blood 4.75E-01 -3.19E-02 -1.34E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.34E-01 -1.22E-01 -4.82E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.12E-02 -1.56E-01 -3.78E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.79E-01 8.19E-02 3.63E-01
Colon cancer 2B90 Colon tissue 6.72E-01 -3.19E-02 -1.05E-01
Coronary artery disease BA80-BA8Z Peripheral blood 1.74E-01 1.92E-01 1.25E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.62E-01 -5.59E-02 -2.17E-01
Endometriosis GA10 Endometrium tissue 2.00E-01 1.14E-01 4.06E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.77E-01 -1.36E-02 -8.35E-02
Familial hypercholesterolemia 5C80.00 Whole blood 5.65E-03 -3.29E-01 -1.58E+00
Gastric cancer 2B72 Gastric tissue 5.38E-01 -1.16E-01 -1.85E-01
Glioblastopma 2A00.00 Nervous tissue 3.02E-21 1.50E-01 4.91E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 4.08E-03 2.15E-01 5.57E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.13E-01 -5.19E-02 -1.59E-01
Head and neck cancer 2D42 Head and neck tissue 1.31E-05 -3.09E-01 -5.05E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.67E-01 1.40E-03 9.25E-03
Huntington's disease 8A01.10 Whole blood 6.97E-02 8.50E-02 2.66E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.35E-03 3.15E-01 1.50E+00
Immunodeficiency 4A00-4A20 Peripheral blood 2.43E-03 1.93E-01 1.39E+00
Influenza 1E30 Whole blood 9.52E-01 2.30E-02 2.91E-01
Interstitial cystitis GC00.3 Bladder tissue 1.38E-01 -4.35E-01 -2.28E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.14E-03 4.22E-01 1.21E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.67E-01 -2.09E-02 -7.35E-02
Ischemic stroke 8B11 Peripheral blood 4.06E-01 -1.16E-02 -7.63E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 4.88E-03 -8.21E-02 -3.46E-01
Lateral sclerosis 8B60.4 Skin 8.38E-01 1.40E-02 8.84E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 2.69E-01 -8.15E-02 -3.50E-01
Liver cancer 2C12.0 Liver tissue 1.83E-01 -1.84E-01 -5.09E-01
Liver failure DB99.7-DB99.8 Liver tissue 5.41E-01 8.87E-03 1.54E-02
Lung cancer 2C25 Lung tissue 8.11E-10 -1.86E-01 -5.70E-01
Lupus erythematosus 4A40 Whole blood 1.14E-01 -2.98E-02 -6.93E-02
Major depressive disorder 6A70-6A7Z Hippocampus 5.23E-01 6.21E-02 3.40E-01
Major depressive disorder 6A70-6A7Z Whole blood 6.48E-01 -2.40E-03 -9.39E-03
Melanoma 2C30 Skin 6.24E-01 7.05E-02 1.04E-01
Multiple myeloma 2A83.1 Peripheral blood 7.91E-01 -1.18E-01 -5.16E-01
Multiple myeloma 2A83.1 Bone marrow 8.00E-02 1.47E-01 9.81E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.83E-01 -5.80E-02 -1.80E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.76E-02 6.35E-02 1.83E-01
Myelofibrosis 2A20.2 Whole blood 6.36E-01 7.41E-02 6.46E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.96E-01 5.21E-02 1.50E-01
Myopathy 8C70.6 Muscle tissue 5.07E-03 2.41E-01 1.76E+00
Neonatal sepsis KA60 Whole blood 7.51E-01 -3.14E-02 -1.13E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.08E-02 -3.62E-01 -1.28E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.48E-01 -5.35E-02 -2.57E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.64E-01 4.96E-02 6.26E-01
Olive pollen allergy CA08.00 Peripheral blood 2.50E-01 7.94E-02 4.31E-01
Oral cancer 2B6E Oral tissue 8.33E-01 -9.58E-04 -3.88E-03
Osteoarthritis FA00-FA0Z Synovial tissue 7.42E-01 2.53E-01 3.00E-01
Osteoporosis FB83.1 Bone marrow 7.43E-01 -8.42E-04 -4.75E-03
Ovarian cancer 2C73 Ovarian tissue 3.23E-04 7.93E-01 2.09E+00
Pancreatic cancer 2C10 Pancreas 4.86E-06 6.21E-01 1.72E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 4.19E-01 -1.05E-02 -6.09E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 7.25E-01 -1.81E-02 -8.38E-02
Pituitary cancer 2D12 Pituitary tissue 2.30E-01 9.15E-02 4.04E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.74E-01 -5.41E-02 -3.06E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.34E-01 7.89E-02 3.49E-01
Polycythemia vera 2A20.4 Whole blood 7.61E-07 1.44E-01 1.43E+00
Pompe disease 5C51.3 Biceps muscle 8.60E-01 8.60E-02 2.83E-01
Preterm birth KA21.4Z Myometrium 4.34E-01 2.26E-02 5.86E-02
Prostate cancer 2C82 Prostate 7.90E-05 -3.87E-01 -9.68E-01
Psoriasis EA90 Skin 5.31E-02 4.14E-02 1.33E-01
Rectal cancer 2B92 Rectal colon tissue 3.62E-01 -1.28E-01 -3.35E-01
Renal cancer 2C90-2C91 Kidney 2.44E-01 -2.12E-01 -6.15E-01
Retinoblastoma 2D02.2 Uvea 9.29E-06 5.42E-01 8.34E+00
Rheumatoid arthritis FA20 Synovial tissue 7.90E-05 8.29E-01 2.86E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.40E-01 8.08E-03 4.53E-02
Schizophrenia 6A20 Prefrontal cortex 2.93E-01 4.08E-02 1.46E-01
Schizophrenia 6A20 Superior temporal cortex 7.40E-02 -8.71E-02 -6.09E-01
Scleroderma 4A42.Z Whole blood 3.67E-01 6.87E-02 3.19E-01
Seizure 8A60-8A6Z Whole blood 2.25E-01 1.16E-02 6.52E-02
Sensitive skin EK0Z Skin 6.14E-01 -5.72E-03 -1.01E-01
Sepsis with septic shock 1G41 Whole blood 4.76E-05 -2.98E-02 -1.01E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.10E-01 1.16E-01 6.01E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.31E-01 8.60E-02 3.83E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.56E-01 3.23E-01 8.80E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.29E-02 2.77E-01 1.59E+00
Skin cancer 2C30-2C3Z Skin 1.29E-10 2.47E-01 7.75E-01
Thrombocythemia 3B63 Whole blood 1.41E-03 8.36E-02 8.06E-01
Thrombocytopenia 3B64 Whole blood 4.93E-01 3.41E-01 3.92E-01
Thyroid cancer 2D10 Thyroid 4.35E-02 -1.21E-01 -3.42E-01
Tibial muscular dystrophy 8C75 Muscle tissue 4.46E-02 -1.59E-01 -4.64E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.08E-01 1.14E-01 4.28E-01
Type 2 diabetes 5A11 Liver tissue 2.30E-01 -1.84E-01 -8.02E-01
Ureter cancer 2C92 Urothelium 9.95E-01 -3.85E-02 -1.77E-01
Uterine cancer 2C78 Endometrium tissue 2.59E-02 -1.10E-01 -3.84E-01
Vitiligo ED63.0 Skin 1.47E-01 -9.16E-02 -5.41E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Poly [ADP-ribose] polymerase 3 (PARP3) DTT Info
DME DTT Type Patented-recorded
1 Patented Agent(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
3-phenyl isoquinolin-1(2H) derivative 1 DMB40HC N. A. N. A. Patented [1]
1 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
ME0328 DMCLT1V Discovery agent N.A. Investigative [2]

References

1 PARP inhibitors as antitumor agents: a patent update (2013-2015).Expert Opin Ther Pat. 2017 Mar;27(3):363-382.
2 Chemical probes to study ADP-ribosylation: synthesis and biochemical evaluation of inhibitors of the human ADP-ribosyltransferase ARTD3/PARP3. J Med Chem. 2013 Dec 12;56(23):9556-68.
3 Mono-ADP-ribosylation catalyzed by arginine-specific ADP-ribosyltransferases. Methods Mol Biol. 2018;1813:149-165.