General Information of Drug-Metabolizing Enzyme (DME) (ID: DE8PQ7T)

DME Name D-aspartate oxidase (DDO)
Synonyms Aspartic oxidase; D-aspartic oxidase; D-Asp oxidase; ChDASPO; ChDDO; DASOX; DDO
Gene Name DDO
UniProt ID
OXDD_HUMAN
INTEDE ID
DME0607
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
8528
EC Number EC: 1.4.3.1
Oxidoreductase
CH-NH2 donor oxidoreductase
Oxygen acceptor oxidoreductase
EC: 1.4.3.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MDTARIAVVGAGVVGLSTAVCISKLVPRCSVTIISDKFTPDTTSDVAAGMLIPHTYPDTP
IHTQKQWFRETFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADVVLGFRKMT
EAELKKFPQYVFGQAFTTLKCECPAYLPWLEKRIKGSGGWTLTRRIEDLWELHPSFDIVV
NCSGLGSRQLAGDSKIFPVRGQVLQVQAPWVEHFIRDGSGLTYIYPGTSHVTLGGTRQKG
DWNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELLARDGQRLPV
VHHYGHGSGGISVHWGTALEAARLVSECVHALRTPIPKSNL
Function This enzyme selectively catalyzes the oxidative deamination of D-aspartate and its N-methylated derivative, N-methyl D-aspartate.
KEGG Pathway
Alanine, aspartate and glutamate metabolism (hsa00250 )
Metabolic pathways (hsa01100 )
Peroxisome (hsa04146 )
Reactome Pathway
Peroxisomal protein import (R-HSA-9033241 )
Glyoxylate metabolism and glycine degradation (R-HSA-389661 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Glutamic acid DMOUT89 N. A. N. A. Phase 3 [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.57E-14 1.22E-01 6.22E-01
Alzheimer's disease 8A20 Entorhinal cortex 9.74E-03 7.91E-02 2.93E-01
Asthma CA23 Nasal and bronchial airway 3.66E-02 1.06E-01 2.56E-01
Behcet's disease 4A62 Peripheral blood 5.38E-01 1.69E-01 8.38E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.40E-01 1.20E-02 2.29E-02
Bladder cancer 2C94 Bladder tissue 6.44E-02 2.59E-01 1.05E+00
Breast cancer 2C60-2C6Z Breast tissue 1.70E-08 -1.82E-01 -6.23E-01
Colon cancer 2B90 Colon tissue 4.61E-05 -2.81E-01 -8.48E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.18E-01 -3.29E-02 -1.88E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.56E-01 -3.82E-02 -2.95E-01
Gastric cancer 2B72 Gastric tissue 6.64E-07 -1.59E-01 -2.49E+01
Glioblastopma 2A00.00 Nervous tissue 4.30E-14 2.10E-01 6.42E-01
Head and neck cancer 2D42 Head and neck tissue 8.04E-10 -2.36E-01 -5.09E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.80E-01 -4.15E-02 -1.36E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.66E-03 3.65E-01 2.98E+00
Interstitial cystitis GC00.3 Bladder tissue 2.28E-02 1.89E-01 1.43E+00
Ischemic stroke 8B11 Peripheral blood 1.73E-01 -1.36E-01 -5.79E-01
Liver cancer 2C12.0 Liver tissue 1.22E-02 -1.23E-01 -2.71E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.45E-04 -5.79E-01 -2.58E+00
Lung cancer 2C25 Lung tissue 2.13E-54 -6.36E-01 -1.93E+00
Lupus erythematosus 4A40 Whole blood 8.88E-01 3.09E-02 9.46E-02
Major depressive disorder 6A70-6A7Z Hippocampus 8.83E-01 1.11E-01 2.13E-01
Multiple myeloma 2A83.1 Bone marrow 6.67E-01 -7.26E-02 -4.09E-01
Multiple myeloma 2A83.1 Peripheral blood 5.37E-01 -3.15E-02 -2.59E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.00E-01 9.04E-02 7.03E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 6.92E-01 8.50E-02 2.78E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.82E-02 2.83E-01 5.83E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.06E-02 -4.21E-01 -1.04E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.23E-01 -1.52E-01 -5.48E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.03E-01 1.21E-01 7.07E-01
Olive pollen allergy CA08.00 Peripheral blood 4.65E-01 6.40E-02 2.80E-01
Oral cancer 2B6E Oral tissue 3.11E-05 -2.17E-01 -9.22E-01
Ovarian cancer 2C73 Ovarian tissue 1.60E-01 1.49E-01 3.83E-01
Pancreatic cancer 2C10 Pancreas 7.61E-02 7.54E-02 3.15E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.07E-01 -1.20E-02 -1.31E-01
Pituitary cancer 2D12 Pituitary tissue 9.03E-01 -2.16E-03 -1.37E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.56E-01 -9.08E-02 -4.88E-01
Pompe disease 5C51.3 Biceps muscle 5.91E-01 9.34E-02 4.71E-01
Prostate cancer 2C82 Prostate 8.41E-01 -9.73E-02 -2.53E-01
Psoriasis EA90 Skin 2.09E-09 -2.35E-01 -7.82E-01
Rectal cancer 2B92 Rectal colon tissue 9.17E-02 -4.39E-01 -1.05E+00
Renal cancer 2C90-2C91 Kidney 8.97E-02 2.41E-01 4.50E-01
Retinoblastoma 2D02.2 Uvea 3.14E-04 -4.53E-01 -2.56E+00
Schizophrenia 6A20 Prefrontal cortex 6.26E-01 5.88E-02 1.76E-01
Schizophrenia 6A20 Superior temporal cortex 3.68E-01 -3.10E-02 -2.94E-01
Scleroderma 4A42.Z Whole blood 1.26E-01 8.42E-02 4.38E-01
Seizure 8A60-8A6Z Whole blood 7.32E-01 2.62E-02 7.49E-02
Sepsis with septic shock 1G41 Whole blood 7.03E-03 -6.00E-02 -2.67E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.77E-01 7.60E-02 6.06E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 8.24E-01 7.79E-03 1.97E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.26E-01 -4.56E-02 -7.56E-01
Skin cancer 2C30-2C3Z Skin 1.03E-01 -8.71E-02 -2.35E-01
Thrombocythemia 3B63 Whole blood 5.05E-01 -1.66E-02 -1.61E-01
Thrombocytopenia 3B64 Whole blood 5.89E-01 1.58E-01 6.38E-01
Thyroid cancer 2D10 Thyroid 1.74E-17 3.62E-01 1.34E+00
Tibial muscular dystrophy 8C75 Muscle tissue 1.70E-03 -2.82E-01 -1.08E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.04E-02 3.02E-01 2.17E+00
Type 2 diabetes 5A11 Liver tissue 8.13E-01 2.91E-02 2.48E-01
Ureter cancer 2C92 Urothelium 8.82E-01 8.71E-03 5.24E-02
Uterine cancer 2C78 Endometrium tissue 8.67E-01 -7.27E-03 -2.64E-02
Vitiligo ED63.0 Skin 9.90E-01 -1.18E-01 -3.10E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 61 Diseases

References

1 Secreted d-aspartate oxidase functions in C. elegans reproduction and development. FEBS J. 2019 Jan;286(1):124-138.