Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE8RJ3F)

DME Name Hydroxyacid-oxoacid transhydrogenase (ADHFE1)
Synonyms Fe-containing alcohol dehydrogenase; Alcohol dehydrogenase iron-containing protein 1; Mitochondrial hydroxyacid-oxoacid transhydrogenase; ADHFE1; HMFT2263; HOT
Gene Name ADHFE1
UniProt ID
HOT_HUMAN
INTEDE ID
DME0213
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
137872
EC Number EC: 1.1.99.24
Oxidoreductase
CH-OH donor oxidoreductase
CH-OH donor oxidoreductase
EC: 1.1.99.24
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAAAARARVAYLLRQLQRAACQCPTHSHTYSQAPGLSPSGKTTDYAFEMAVSNIRYGAAV
TKEVGMDLKNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDSSFM
EAIEFAQKGAFDAYVAVGGGSTMDTCKAANLYASSPHSDFLDYVSAPIGKGKPVSVPLKP
LIAVPTTSGTGSETTGVAIFDYEHLKVKIGITSRAIKPTLGLIDPLHTLHMPARVVANSG
FDVLCHALESYTTLPYHLRSPCPSNPITRPAYQGSNPISDIWAIHALRIVAKYLKRAVRN
PDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKMYKAKDYNVDHPLVPHGLS
VVLTSPAVFTFTAQMFPERHLEMAEILGADTRTARIQDAGLVLADTLRKFLFDLDVDDGL
AAVGYSKADIPALVKGTLPQERVTKLAPCPQSEEDLAALFEASMKLY
Function
This enzyme catalyzes the cofactor-independent reversible oxidation of gamma-hydroxybutyrate (GHB) to succinic semialdehyde (SSA) coupled to reduction of 2-ketoglutarate (2-KG) to D-2-hydroxyglutarate (D-2-HG). D,L-3-hydroxyisobutyrate and L-3-hydroxybutyrate (L-3-OHB) are also substrates for HOT with 10-fold lower activities.
Reactome Pathway
Interconversion of 2-oxoglutarate and 2-hydroxyglutarate (R-HSA-880009 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Sodium oxybate DMBOV5P Narcolepsy 7A20 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.42E-11 3.07E-01 8.15E-01
Alopecia ED70 Skin from scalp 4.62E-07 4.12E-01 1.19E+00
Alzheimer's disease 8A20 Entorhinal cortex 5.74E-01 8.71E-02 2.10E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.52E-01 3.90E-02 2.33E-01
Aortic stenosis BB70 Calcified aortic valve 2.82E-02 -2.21E-01 -5.40E-01
Apnea 7A40 Hyperplastic tonsil 2.30E-01 2.96E-01 1.24E+00
Arthropathy FA00-FA5Z Peripheral blood 3.53E-01 -1.83E-01 -6.79E-01
Asthma CA23 Nasal and bronchial airway 6.10E-01 6.24E-02 9.87E-02
Atopic dermatitis EA80 Skin 1.46E-02 -2.21E-01 -7.52E-01
Autism 6A02 Whole blood 4.63E-01 3.77E-02 1.50E-01
Autoimmune uveitis 9A96 Peripheral monocyte 9.71E-01 2.65E-02 5.30E-02
Autosomal dominant monocytopenia 4B04 Whole blood 7.43E-01 1.28E-02 5.85E-02
Bacterial infection of gingival 1C1H Gingival tissue 1.07E-01 1.03E-01 2.88E-01
Batten disease 5C56.1 Whole blood 1.51E-01 3.79E-01 9.08E-01
Behcet's disease 4A62 Peripheral blood 3.95E-01 -2.81E-02 -7.56E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.59E-02 1.03E-01 3.46E-01
Bladder cancer 2C94 Bladder tissue 1.06E-03 -3.97E-01 -1.87E+00
Breast cancer 2C60-2C6Z Breast tissue 2.93E-97 -1.04E+00 -1.94E+00
Cardioembolic stroke 8B11.20 Whole blood 4.84E-04 -1.93E-01 -7.63E-01
Cervical cancer 2C77 Cervical tissue 4.86E-01 3.37E-02 1.18E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.61E-01 -2.41E-01 -3.53E-01
Chronic hepatitis C 1E51.1 Whole blood 6.68E-02 -3.04E-01 -7.08E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.01E-01 -1.01E-01 -2.66E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.90E-02 -2.29E-01 -6.61E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.85E-02 -3.11E-01 -1.09E+00
Colon cancer 2B90 Colon tissue 2.09E-53 -6.10E-01 -1.95E+00
Coronary artery disease BA80-BA8Z Peripheral blood 9.69E-01 1.36E-01 3.03E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.77E-02 1.13E-01 2.74E-01
Endometriosis GA10 Endometrium tissue 1.18E-02 5.10E-01 1.13E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.77E-01 -2.24E-01 -1.17E+00
Familial hypercholesterolemia 5C80.00 Whole blood 3.16E-01 1.26E-01 5.40E-01
Gastric cancer 2B72 Gastric tissue 1.41E-03 -2.25E+00 -1.30E+01
Glioblastopma 2A00.00 Nervous tissue 4.78E-20 -3.28E-01 -6.62E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.52E-02 5.37E-01 3.13E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.10E-01 -2.56E-01 -4.01E-01
Head and neck cancer 2D42 Head and neck tissue 3.79E-18 -1.09E+00 -1.17E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.38E-01 1.36E-01 3.94E-01
Huntington's disease 8A01.10 Whole blood 9.28E-02 5.03E-01 1.11E+00
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.34E-01 -6.15E-01 -9.67E-01
Immunodeficiency 4A00-4A20 Peripheral blood 9.39E-03 -4.20E-01 -1.28E+00
Influenza 1E30 Whole blood 1.93E-02 2.24E-01 1.97E+00
Interstitial cystitis GC00.3 Bladder tissue 2.13E-03 -6.08E-01 -2.76E+00
Intracranial aneurysm 8B01.0 Intracranial artery 4.44E-04 -5.25E-01 -1.29E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.33E-01 -1.69E-01 -3.36E-01
Ischemic stroke 8B11 Peripheral blood 1.31E-01 3.78E-01 9.27E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.52E-02 -4.19E-02 -6.70E-02
Lateral sclerosis 8B60.4 Skin 9.56E-01 5.81E-02 3.60E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 8.07E-01 -1.73E-01 -4.97E-01
Liver cancer 2C12.0 Liver tissue 4.24E-11 -7.18E-01 -1.28E+00
Liver failure DB99.7-DB99.8 Liver tissue 7.60E-08 -2.01E+00 -5.30E+00
Lung cancer 2C25 Lung tissue 9.63E-61 -7.41E-01 -1.93E+00
Lupus erythematosus 4A40 Whole blood 5.75E-02 1.33E-01 2.36E-01
Major depressive disorder 6A70-6A7Z Hippocampus 3.01E-01 -4.10E-02 -1.34E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.18E-01 -1.20E-01 -3.16E-01
Melanoma 2C30 Skin 1.08E-01 -3.49E-01 -3.39E-01
Multiple myeloma 2A83.1 Peripheral blood 3.37E-01 4.64E-01 5.56E-01
Multiple myeloma 2A83.1 Bone marrow 5.26E-03 -3.24E-01 -1.91E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.58E-01 5.76E-02 2.55E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.08E-03 1.54E-01 5.11E-01
Myelofibrosis 2A20.2 Whole blood 6.20E-01 -1.41E-02 -8.71E-02
Myocardial infarction BA41-BA50 Peripheral blood 1.78E-01 -6.72E-01 -7.15E-01
Myopathy 8C70.6 Muscle tissue 9.57E-01 -3.19E-03 -5.48E-03
Neonatal sepsis KA60 Whole blood 2.66E-10 -3.30E-01 -1.03E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 9.10E-07 -1.82E+00 -4.12E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.33E-01 -3.12E-01 -1.12E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.10E-01 1.72E-01 7.91E-01
Olive pollen allergy CA08.00 Peripheral blood 7.60E-01 8.39E-02 2.13E-01
Oral cancer 2B6E Oral tissue 8.07E-04 -6.43E-01 -7.31E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.98E-01 -1.86E-01 -1.69E-01
Osteoporosis FB83.1 Bone marrow 9.27E-01 0.00E+00 0.00E+00
Ovarian cancer 2C73 Ovarian tissue 3.86E-04 -9.75E-01 -2.08E+00
Pancreatic cancer 2C10 Pancreas 2.29E-04 -5.99E-01 -1.56E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 9.31E-02 -7.70E-02 -3.17E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.74E-02 -1.25E-01 -4.52E-01
Pituitary cancer 2D12 Pituitary tissue 5.30E-02 -3.62E-01 -6.64E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.45E-01 -3.04E-02 -5.77E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.70E-02 -4.32E-02 -2.09E-01
Polycythemia vera 2A20.4 Whole blood 4.32E-04 -1.40E-02 -9.23E-02
Pompe disease 5C51.3 Biceps muscle 2.61E-04 -1.00E+00 -2.22E+00
Preterm birth KA21.4Z Myometrium 3.01E-02 9.27E-01 2.43E+00
Prostate cancer 2C82 Prostate 4.46E-01 4.63E-01 9.98E-01
Psoriasis EA90 Skin 3.82E-01 -1.20E-01 -3.31E-01
Rectal cancer 2B92 Rectal colon tissue 2.29E-02 -5.57E-01 -1.75E+00
Renal cancer 2C90-2C91 Kidney 1.24E-03 -8.17E-01 -1.56E+00
Retinoblastoma 2D02.2 Uvea 8.74E-07 1.51E+00 3.07E+00
Rheumatoid arthritis FA20 Synovial tissue 7.28E-02 -3.60E-01 -3.70E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.37E-02 -1.37E-01 -5.50E-01
Schizophrenia 6A20 Prefrontal cortex 4.40E-01 -9.37E-02 -2.86E-01
Schizophrenia 6A20 Superior temporal cortex 4.90E-01 4.34E-03 2.35E-02
Scleroderma 4A42.Z Whole blood 8.23E-02 -8.80E-02 -3.40E-01
Seizure 8A60-8A6Z Whole blood 8.61E-01 1.45E-02 7.10E-02
Sensitive skin EK0Z Skin 4.19E-01 -1.00E-01 -4.05E-01
Sepsis with septic shock 1G41 Whole blood 9.64E-51 -5.38E-01 -1.76E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.63E-01 2.90E-03 9.41E-03
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.74E-01 -9.32E-02 -2.64E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 6.94E-01 1.82E-02 8.09E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.40E-01 -3.23E-02 -1.22E-01
Skin cancer 2C30-2C3Z Skin 6.07E-02 9.25E-02 1.78E-01
Thrombocythemia 3B63 Whole blood 2.15E-02 -1.21E-01 -7.82E-01
Thrombocytopenia 3B64 Whole blood 2.07E-01 3.46E-01 6.86E-01
Thyroid cancer 2D10 Thyroid 1.08E-22 -4.49E-01 -1.47E+00
Tibial muscular dystrophy 8C75 Muscle tissue 1.03E-01 -2.75E-01 -5.36E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.71E-02 3.63E-01 2.51E+00
Type 2 diabetes 5A11 Liver tissue 7.34E-02 -5.43E-01 -1.26E+00
Ureter cancer 2C92 Urothelium 1.03E-01 -6.24E-02 -3.82E-01
Uterine cancer 2C78 Endometrium tissue 1.08E-05 -3.63E-01 -7.77E-01
Vitiligo ED63.0 Skin 9.67E-02 -2.07E-01 -9.05E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Kinetic characterization of human hydroxyacid-oxoacid transhydrogenase: relevance to D-2-hydroxyglutaric and gamma-hydroxybutyric acidurias. J Inherit Metab Dis. 2005;28(6):921-30.