Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE915QP)

DME Name Ketoacyl-CoA reductase (HSD17B12)
Synonyms
Very-long-chain 3-oxoacyl-CoA reductase; Short chain dehydrogenase/reductase family 12C member 1; 17-beta-HSD 12; 17-beta-hydroxysteroid dehydrogenase 12; 3-ketoacyl-CoA reductase; Estradiol 17-beta-dehydrogenase 12; HSD17B12; KAR; SDR12C1
Gene Name HSD17B12
UniProt ID
DHB12_HUMAN
INTEDE ID
DME0421
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
51144
EC Number EC: 1.1.1.330
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.330
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MESALPAAGFLYWVGAGTVAYLALRISYSLFTALRVWGVGNEAGVGPGLGEWAVVTGSTD
GIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEIKEKFKVETRTIAVDFASEDIYDKIKT
GLAGLEIGILVNNVGMSYEYPEYFLDVPDLDNVIKKMININILSVCKMTQLVLPGMVERS
KGAILNISSGSGMLPVPLLTIYSATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLA
KIRKPTLDKPSPETFVKSAIKTVGLQSRTNGYLIHALMGSIISNLPSWIYLKIVMNMNKS
TRAHYLKKTKKN
Function
This enzyme catalyzes the second of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme has a 3-ketoacyl-CoA reductase activity, reducing 3-ketoacyl-CoA to 3- hydroxyacyl-CoA, within each cycle of fatty acid elongation. It may also catalyze the transformation of estrone (E1) into estradiol (E2) and play a role in estrogen formation.
KEGG Pathway
Biosynthesis of unsaturated fatty acids (hsa01040 )
Fatty acid elongation (hsa00062 )
Fatty acid metabolism (hsa01212 )
Metabolic pathways (hsa01100 )
Steroid hormone biosynthesis (hsa00140 )
Reactome Pathway
Synthesis of very long-chain fatty acyl-CoAs (R-HSA-75876 )
Androgen biosynthesis (R-HSA-193048 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Estrone DM5T6US Acne vulgaris ED80 Approved [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
Estrone Acne vulgaris [ED80] Approved Km = 0.0025 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 8.84E-02 -4.50E-02 -1.71E-01
Alopecia ED70 Skin from scalp 4.42E-02 9.33E-02 1.97E-01
Alzheimer's disease 8A20 Entorhinal cortex 8.63E-05 -6.97E-02 -2.02E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.37E-01 -2.64E-01 -8.42E-01
Aortic stenosis BB70 Calcified aortic valve 8.07E-01 -7.93E-02 -1.05E-01
Apnea 7A40 Hyperplastic tonsil 5.60E-01 -1.01E-01 -4.71E-01
Arthropathy FA00-FA5Z Peripheral blood 2.87E-01 3.42E-02 3.69E-01
Asthma CA23 Nasal and bronchial airway 1.58E-02 -1.18E-01 -1.66E-01
Atopic dermatitis EA80 Skin 5.23E-01 -1.39E-01 -5.10E-01
Autism 6A02 Whole blood 2.24E-01 -3.71E-02 -3.26E-01
Autoimmune uveitis 9A96 Peripheral monocyte 9.59E-01 1.12E-01 5.84E-01
Autosomal dominant monocytopenia 4B04 Whole blood 9.30E-01 -9.90E-02 -3.60E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.67E-02 -6.25E-02 -3.36E-01
Batten disease 5C56.1 Whole blood 7.22E-01 7.79E-03 2.86E-02
Behcet's disease 4A62 Peripheral blood 8.97E-01 -4.26E-02 -2.40E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.75E-02 -1.32E-01 -7.46E-01
Bladder cancer 2C94 Bladder tissue 1.60E-02 3.10E-01 1.06E+00
Breast cancer 2C60-2C6Z Breast tissue 4.50E-07 4.74E-02 2.41E-01
Cardioembolic stroke 8B11.20 Whole blood 1.84E-01 1.76E-02 4.39E-02
Cervical cancer 2C77 Cervical tissue 9.86E-01 -2.06E-02 -1.16E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.54E-02 -8.75E-02 -7.66E-01
Chronic hepatitis C 1E51.1 Whole blood 3.72E-02 2.27E-01 8.63E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 6.20E-02 9.17E-02 6.08E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.78E-01 -4.55E-03 -1.66E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.18E-01 -2.61E-02 -2.09E-01
Colon cancer 2B90 Colon tissue 6.51E-47 3.04E-01 1.32E+00
Coronary artery disease BA80-BA8Z Peripheral blood 3.26E-02 -2.19E-01 -1.58E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.00E-01 2.52E-01 4.92E-01
Endometriosis GA10 Endometrium tissue 7.90E-01 2.33E-03 1.01E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.05E-02 -1.38E-02 -1.05E-01
Familial hypercholesterolemia 5C80.00 Whole blood 8.73E-04 -1.88E-01 -1.06E+00
Gastric cancer 2B72 Gastric tissue 2.34E-02 2.75E-01 2.74E+00
Glioblastopma 2A00.00 Nervous tissue 6.17E-01 -3.35E-03 -1.19E-02
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 8.71E-01 -3.15E-03 -3.83E-02
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.78E-01 2.44E-01 2.71E-01
Head and neck cancer 2D42 Head and neck tissue 6.35E-06 -1.22E-01 -6.04E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.98E-01 -4.25E-02 -3.77E-01
Huntington's disease 8A01.10 Whole blood 2.77E-01 -1.29E-02 -1.25E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.67E-01 1.75E-02 5.01E-02
Immunodeficiency 4A00-4A20 Peripheral blood 2.32E-01 3.43E-02 1.86E-01
Influenza 1E30 Whole blood 1.70E-01 4.16E-01 1.36E+00
Interstitial cystitis GC00.3 Bladder tissue 8.47E-01 -1.76E-03 -9.40E-03
Intracranial aneurysm 8B01.0 Intracranial artery 4.97E-03 -2.12E-01 -1.18E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.05E-01 1.28E-01 3.13E-01
Ischemic stroke 8B11 Peripheral blood 9.99E-01 -2.87E-02 -2.41E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.41E-02 1.46E-01 3.12E-01
Lateral sclerosis 8B60.4 Skin 1.62E-01 1.42E-01 1.36E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 9.66E-01 1.73E-02 6.18E-02
Liver cancer 2C12.0 Liver tissue 1.19E-01 -9.99E-02 -3.10E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.09E-01 -2.14E-01 -6.57E-01
Lung cancer 2C25 Lung tissue 9.88E-14 1.33E-01 5.55E-01
Lupus erythematosus 4A40 Whole blood 1.75E-01 1.32E-02 5.04E-02
Major depressive disorder 6A70-6A7Z Hippocampus 8.19E-02 -1.13E-01 -6.19E-01
Major depressive disorder 6A70-6A7Z Whole blood 5.73E-01 1.98E-02 7.97E-02
Melanoma 2C30 Skin 1.83E-01 -3.48E-01 -3.71E-01
Multiple myeloma 2A83.1 Peripheral blood 7.61E-01 7.97E-02 4.16E-01
Multiple myeloma 2A83.1 Bone marrow 5.13E-01 -7.68E-02 -4.02E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.76E-01 -1.30E-01 -2.17E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.33E-01 6.72E-02 1.90E-01
Myelofibrosis 2A20.2 Whole blood 6.81E-04 2.17E-01 1.44E+00
Myocardial infarction BA41-BA50 Peripheral blood 6.34E-02 -4.30E-01 -4.49E-01
Myopathy 8C70.6 Muscle tissue 6.38E-01 1.76E-02 1.40E-01
Neonatal sepsis KA60 Whole blood 2.41E-01 1.31E-02 9.73E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.45E-03 1.90E-01 1.22E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 8.58E-01 1.84E-02 1.34E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.56E-01 -2.87E-02 -8.87E-02
Olive pollen allergy CA08.00 Peripheral blood 1.51E-01 1.62E-01 1.40E+00
Oral cancer 2B6E Oral tissue 4.32E-01 3.81E-02 1.59E-01
Osteoarthritis FA00-FA0Z Synovial tissue 6.30E-01 -3.90E-02 -1.48E-01
Osteoporosis FB83.1 Bone marrow 5.09E-01 7.08E-02 3.91E-01
Ovarian cancer 2C73 Ovarian tissue 9.75E-02 1.74E-02 1.48E-01
Pancreatic cancer 2C10 Pancreas 5.98E-03 -3.90E-01 -1.01E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 1.18E-01 -8.23E-02 -4.95E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.14E-01 -3.88E-02 -2.81E-01
Pituitary cancer 2D12 Pituitary tissue 1.32E-01 2.24E-01 6.57E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.41E-01 1.99E-01 6.05E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.23E-01 -2.25E-03 -2.36E-02
Polycythemia vera 2A20.4 Whole blood 1.06E-03 6.84E-02 4.41E-01
Pompe disease 5C51.3 Biceps muscle 8.28E-01 1.71E-02 6.52E-02
Preterm birth KA21.4Z Myometrium 3.95E-01 -5.56E-02 -3.52E-01
Prostate cancer 2C82 Prostate 1.23E-07 1.18E+00 2.20E+00
Psoriasis EA90 Skin 6.75E-11 2.52E-01 8.02E-01
Rectal cancer 2B92 Rectal colon tissue 6.84E-01 -1.12E-01 -5.40E-01
Renal cancer 2C90-2C91 Kidney 5.04E-02 1.21E-01 7.45E-01
Retinoblastoma 2D02.2 Uvea 5.46E-01 1.77E-01 6.58E-01
Rheumatoid arthritis FA20 Synovial tissue 4.61E-02 -5.69E-01 -1.37E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.98E-01 -1.10E-02 -9.23E-02
Schizophrenia 6A20 Prefrontal cortex 2.03E-01 -5.76E-02 -2.97E-01
Schizophrenia 6A20 Superior temporal cortex 3.22E-01 3.57E-02 3.70E-01
Scleroderma 4A42.Z Whole blood 3.98E-04 1.83E-01 1.64E+00
Seizure 8A60-8A6Z Whole blood 8.04E-01 -3.23E-02 -2.45E-01
Sensitive skin EK0Z Skin 3.37E-01 -1.66E-01 -5.86E-01
Sepsis with septic shock 1G41 Whole blood 3.79E-03 4.53E-02 2.80E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.91E-01 2.33E-01 3.76E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.83E-02 5.33E-02 5.03E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.69E-01 -2.65E-02 -4.30E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 9.40E-01 6.82E-02 3.18E-01
Skin cancer 2C30-2C3Z Skin 1.33E-13 2.80E-01 6.10E-01
Thrombocythemia 3B63 Whole blood 3.29E-03 1.73E-01 1.07E+00
Thrombocytopenia 3B64 Whole blood 1.54E-01 -3.36E-01 -9.99E-01
Thyroid cancer 2D10 Thyroid 1.99E-02 1.73E-02 7.97E-02
Tibial muscular dystrophy 8C75 Muscle tissue 4.64E-02 -1.04E-01 -6.14E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.84E-01 -8.56E-02 -4.64E-01
Type 2 diabetes 5A11 Liver tissue 9.11E-02 -5.85E-02 -5.74E-01
Ureter cancer 2C92 Urothelium 6.84E-01 2.96E-02 1.98E-01
Uterine cancer 2C78 Endometrium tissue 3.60E-21 2.46E-01 1.08E+00
Vitiligo ED63.0 Skin 2.54E-01 2.73E-01 4.96E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Characterization of type 12 17beta-hydroxysteroid dehydrogenase, an isoform of type 3 17beta-hydroxysteroid dehydrogenase responsible for estradiol formation in women. Mol Endocrinol. 2006 Feb;20(2):437-43.