General Information of Drug-Metabolizing Enzyme (DME) (ID: DE9A2LB)

DME Name Microsomal cytochrome MCB5 (CYB5A)
Synonyms Microsomal cytochrome b5 type A; Cytochrome b5; MCB5; CYB5; CYB5A
Gene Name CYB5A
UniProt ID
CYB5_HUMAN
INTEDE ID
DME0411
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1528
EC Number EC: 1.14.14.1
Oxidoreductase
Oxygen paired donor oxidoreductase
Flavin/flavoprotein donor oxidoreductase
EC: 1.14.14.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDAT
ENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISA
VAVALMYRLYMAED
Function This enzyme functions as an electron carrier for several membrane-bound oxygenases.
Reactome Pathway
Vitamin C (ascorbate) metabolism (R-HSA-196836 )
Insertion of tail-anchored proteins into the endoplasmic reticulum membrane [P00167-1] (R-HSA-9609523 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Halothane DM80OZ5 Anaesthesia 9A78.6 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.62E-07 -3.52E-01 -5.86E-01
Alopecia ED70 Skin from scalp 2.11E-03 1.34E-01 3.22E-01
Alzheimer's disease 8A20 Entorhinal cortex 8.92E-01 2.47E-02 8.27E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 4.97E-01 1.19E-01 3.94E-01
Aortic stenosis BB70 Calcified aortic valve 5.90E-01 -2.87E-01 -2.48E-01
Apnea 7A40 Hyperplastic tonsil 1.67E-01 -6.84E-01 -8.66E-01
Arthropathy FA00-FA5Z Peripheral blood 2.33E-01 -1.86E-01 -9.33E-01
Asthma CA23 Nasal and bronchial airway 3.40E-01 -1.20E-01 -1.78E-01
Atopic dermatitis EA80 Skin 1.38E-03 -5.24E-01 -1.07E+00
Autism 6A02 Whole blood 1.07E-01 -1.52E-01 -4.32E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.55E-01 5.75E-01 1.38E+00
Autosomal dominant monocytopenia 4B04 Whole blood 7.46E-01 -1.14E-01 -3.16E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.08E-19 -4.86E-01 -1.72E+00
Batten disease 5C56.1 Whole blood 6.94E-01 -1.39E-01 -5.92E-01
Behcet's disease 4A62 Peripheral blood 7.53E-01 -7.57E-02 -3.80E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.58E-01 3.83E-02 2.79E-01
Bladder cancer 2C94 Bladder tissue 2.03E-07 -1.46E+00 -4.26E+00
Breast cancer 2C60-2C6Z Breast tissue 4.78E-07 -2.13E-01 -2.65E-01
Cardioembolic stroke 8B11.20 Whole blood 2.78E-02 -2.17E-01 -9.09E-01
Cervical cancer 2C77 Cervical tissue 3.79E-02 -1.52E-01 -3.14E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.22E-01 -7.07E-02 -6.61E-02
Chronic hepatitis C 1E51.1 Whole blood 9.21E-02 -1.67E-01 -5.17E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.49E-01 1.22E-02 4.73E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.70E-02 -1.62E-01 -5.75E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.61E-03 -1.01E+00 -1.47E+00
Colon cancer 2B90 Colon tissue 7.34E-12 -2.47E-01 -6.78E-01
Coronary artery disease BA80-BA8Z Peripheral blood 1.24E-01 7.74E-01 1.22E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.32E-01 1.75E-02 3.17E-02
Endometriosis GA10 Endometrium tissue 3.12E-02 -5.14E-01 -4.66E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.00E-02 2.08E-01 7.23E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.16E-01 5.73E-02 2.11E-01
Gastric cancer 2B72 Gastric tissue 3.56E-01 -9.83E-01 -1.01E+00
Glioblastopma 2A00.00 Nervous tissue 6.18E-49 6.03E-01 1.10E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 9.65E-01 5.16E-02 9.84E-02
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.19E-02 5.26E-01 8.05E-01
Head and neck cancer 2D42 Head and neck tissue 4.15E-23 -8.83E-01 -7.90E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.78E-01 2.21E-01 6.09E-01
Huntington's disease 8A01.10 Whole blood 5.43E-01 -5.04E-02 -2.24E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.31E-01 -2.00E-01 -6.89E-01
Immunodeficiency 4A00-4A20 Peripheral blood 6.27E-01 7.13E-02 3.49E-01
Influenza 1E30 Whole blood 2.28E-01 -3.18E-01 -7.95E-01
Interstitial cystitis GC00.3 Bladder tissue 1.41E-06 -2.33E+00 -7.76E+00
Intracranial aneurysm 8B01.0 Intracranial artery 4.45E-01 1.37E-01 3.71E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.77E-02 -3.93E-01 -9.71E-01
Ischemic stroke 8B11 Peripheral blood 7.03E-01 -4.51E-02 -1.71E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.62E-06 -1.90E-01 -5.02E-01
Lateral sclerosis 8B60.4 Skin 5.90E-01 2.29E-01 7.36E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 5.04E-02 -4.62E-01 -7.62E-01
Liver cancer 2C12.0 Liver tissue 1.34E-32 -5.54E-01 -2.41E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.14E-03 -2.50E+00 -8.10E+00
Lung cancer 2C25 Lung tissue 5.33E-124 -1.08E+00 -3.09E+00
Lupus erythematosus 4A40 Whole blood 3.70E-01 1.39E-01 1.78E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.02E-01 -2.11E-03 -1.61E-02
Major depressive disorder 6A70-6A7Z Whole blood 1.81E-01 -2.06E-02 -6.11E-02
Melanoma 2C30 Skin 3.42E-06 -1.81E+00 -1.57E+00
Multiple myeloma 2A83.1 Peripheral blood 6.49E-01 2.40E-02 5.52E-02
Multiple myeloma 2A83.1 Bone marrow 5.41E-03 7.50E-01 1.87E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.95E-02 -2.20E-01 -7.29E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.85E-03 2.40E-01 5.58E-01
Myelofibrosis 2A20.2 Whole blood 1.15E-02 1.07E+00 5.03E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.62E-06 -3.71E-01 -8.07E-01
Myopathy 8C70.6 Muscle tissue 3.26E-05 4.78E-01 3.12E+00
Neonatal sepsis KA60 Whole blood 9.52E-03 -2.33E-01 -5.01E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.93E-03 4.76E-01 1.30E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.77E-01 1.96E-01 7.45E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.22E-01 -3.60E-02 -2.14E-01
Olive pollen allergy CA08.00 Peripheral blood 9.57E-01 -1.25E-01 -3.96E-01
Oral cancer 2B6E Oral tissue 1.38E-02 -1.65E-01 -2.56E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.07E-01 -1.40E-01 -2.92E-01
Osteoporosis FB83.1 Bone marrow 2.09E-01 -2.89E-01 -8.79E-01
Ovarian cancer 2C73 Ovarian tissue 4.50E-02 -6.76E-01 -8.65E-01
Pancreatic cancer 2C10 Pancreas 3.07E-03 -8.18E-01 -1.12E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 8.17E-01 -6.51E-02 -2.10E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 7.73E-01 -9.22E-03 -4.55E-02
Pituitary cancer 2D12 Pituitary tissue 6.42E-01 -1.16E-01 -3.19E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.35E-02 -2.47E-01 -7.99E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.69E-01 1.54E-01 4.76E-01
Polycythemia vera 2A20.4 Whole blood 1.96E-08 2.42E-01 1.15E+00
Pompe disease 5C51.3 Biceps muscle 1.03E-01 1.40E-01 8.65E-01
Preterm birth KA21.4Z Myometrium 6.30E-01 8.02E-02 1.49E-01
Prostate cancer 2C82 Prostate 6.50E-01 -6.31E-02 -1.08E-01
Psoriasis EA90 Skin 2.53E-08 -3.30E-01 -7.31E-01
Rectal cancer 2B92 Rectal colon tissue 7.77E-04 -9.28E-01 -2.92E+00
Renal cancer 2C90-2C91 Kidney 1.29E-02 -2.62E-01 -3.63E-01
Retinoblastoma 2D02.2 Uvea 2.55E-05 1.01E+00 3.92E+00
Rheumatoid arthritis FA20 Synovial tissue 1.04E-01 -7.72E-02 -1.57E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.08E-01 -7.84E-02 -2.17E-01
Schizophrenia 6A20 Prefrontal cortex 9.62E-01 2.46E-02 7.97E-02
Schizophrenia 6A20 Superior temporal cortex 6.80E-02 -6.02E-02 -3.41E-01
Scleroderma 4A42.Z Whole blood 6.42E-04 -2.86E-01 -1.32E+00
Seizure 8A60-8A6Z Whole blood 9.17E-01 1.33E-01 2.65E-01
Sensitive skin EK0Z Skin 1.22E-01 -1.52E-01 -1.06E+00
Sepsis with septic shock 1G41 Whole blood 8.07E-10 -4.04E-01 -8.58E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.31E-01 3.64E-02 1.34E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.03E-03 -4.96E-01 -7.96E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.46E-01 -6.04E-02 -2.84E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.84E-01 -2.93E-01 -1.81E+00
Skin cancer 2C30-2C3Z Skin 2.54E-114 -1.65E+00 -2.92E+00
Thrombocythemia 3B63 Whole blood 2.70E-02 2.14E-01 1.04E+00
Thrombocytopenia 3B64 Whole blood 7.12E-01 4.61E-01 7.43E-01
Thyroid cancer 2D10 Thyroid 8.20E-03 -1.32E-01 -4.28E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.21E-04 4.48E-01 1.28E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.73E-01 1.02E-01 6.78E-01
Type 2 diabetes 5A11 Liver tissue 2.06E-01 6.02E-02 6.97E-01
Ureter cancer 2C92 Urothelium 9.56E-01 -1.25E-01 -1.40E-01
Uterine cancer 2C78 Endometrium tissue 1.87E-05 -1.91E-01 -2.01E-01
Vitiligo ED63.0 Skin 9.46E-01 -1.72E-01 -3.54E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Modulation of the reductive metabolism of halothane by microsomal cytochrome b5 in rat liver. Biochim Biophys Acta. 1987 Dec 7;926(3):231-8.