Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE9B45K)

DME Name Cytosolic branched aminotransferase (BCAT1)
Synonyms Cytosolic branched-chain-amino-acid aminotransferase; Protein ECA39; ECA39; BCAT(c); BCAT1; BCT1
Gene Name BCAT1
UniProt ID
BCAT1_HUMAN
INTEDE ID
DME0177
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
586
EC Number EC: 2.6.1.42
Transferase
Transaminase
Transaminase
EC: 2.6.1.42
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTV
EWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMDRM
YRSAVRATLPVFDKEELLECIQQLVKLDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPTK
ALLFVLLSPVGPYFSSGTFNPVSLWANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEAVDN
GCQQVLWLYGEDHQITEVGTMNLFLYWINEDGEEELATPPLDGIILPGVTRRCILDLAHQ
WGEFKVSERYLTMDDLTTALEGNRVREMFGSGTACVVCPVSDILYKGETIHIPTMENGPK
LASRILSKLTDIQYGREESDWTIVLS
Function This enzyme catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine.
KEGG Pathway
2-Oxocarboxylic acid metabolism (hsa01210 )
Biosynthesis of amino acids (hsa01230 )
Cysteine and methionine metabolism (hsa00270 )
Metabolic pathways (hsa01100 )
Pantothenate and CoA biosynthesis (hsa00770 )
Valine, leucine and isoleucine biosynthesis (hsa00290 )
Valine, leucine and isoleucine degradation (hsa00280 )
Reactome Pathway
Branched-chain amino acid catabolism (R-HSA-70895 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-valine DM68RPD Discovery agent N.A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.85E-21 8.90E-01 1.68E+00
Alopecia ED70 Skin from scalp 2.89E-06 2.78E-01 1.08E+00
Alzheimer's disease 8A20 Entorhinal cortex 2.58E-06 -2.98E-01 -6.91E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.67E-01 2.30E-01 3.84E-01
Aortic stenosis BB70 Calcified aortic valve 4.73E-02 7.55E-01 1.31E+00
Apnea 7A40 Hyperplastic tonsil 3.34E-01 3.65E-01 7.52E-01
Arthropathy FA00-FA5Z Peripheral blood 6.84E-01 1.42E-01 3.42E-01
Asthma CA23 Nasal and bronchial airway 5.32E-07 9.90E-01 7.85E-01
Atopic dermatitis EA80 Skin 1.21E-04 -3.49E-01 -1.10E+00
Autism 6A02 Whole blood 2.01E-01 2.04E-01 5.35E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.00E-01 -1.95E-01 -3.42E-01
Autosomal dominant monocytopenia 4B04 Whole blood 9.66E-01 -4.07E-01 -4.86E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.47E-10 5.43E-01 1.09E+00
Batten disease 5C56.1 Whole blood 8.95E-01 -4.80E-02 -1.07E-01
Behcet's disease 4A62 Peripheral blood 1.85E-02 3.98E-01 1.15E+00
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.95E-01 -4.10E-02 -1.77E-01
Bladder cancer 2C94 Bladder tissue 9.89E-01 5.57E-02 1.54E-01
Breast cancer 2C60-2C6Z Breast tissue 1.31E-04 8.58E-02 1.13E-01
Cardioembolic stroke 8B11.20 Whole blood 3.74E-05 8.44E-01 1.37E+00
Cervical cancer 2C77 Cervical tissue 1.78E-02 1.23E+00 1.13E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.63E-01 4.56E-02 5.40E-02
Chronic hepatitis C 1E51.1 Whole blood 1.54E-01 6.61E-01 1.25E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 3.97E-01 2.43E-01 3.87E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.42E-03 3.15E-01 5.30E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.76E-02 1.67E+00 1.96E+00
Colon cancer 2B90 Colon tissue 1.71E-52 1.01E+00 1.78E+00
Coronary artery disease BA80-BA8Z Peripheral blood 7.41E-02 8.58E-01 1.87E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.82E-01 2.31E-01 2.78E-01
Endometriosis GA10 Endometrium tissue 2.54E-03 8.78E-01 8.22E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.93E-01 -3.64E-01 -8.22E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.66E-06 1.29E+00 1.78E+00
Gastric cancer 2B72 Gastric tissue 6.47E-16 1.03E+00 2.66E+01
Glioblastopma 2A00.00 Nervous tissue 7.46E-11 2.38E-01 4.32E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.63E-02 8.10E-01 3.65E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.05E-01 4.97E-02 5.61E-02
Head and neck cancer 2D42 Head and neck tissue 4.38E-32 1.49E+00 1.80E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.40E-02 -1.79E-01 -6.03E-01
Huntington's disease 8A01.10 Whole blood 8.22E-01 3.39E-02 1.01E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.24E-01 -3.59E-01 -1.46E+00
Immunodeficiency 4A00-4A20 Peripheral blood 1.71E-05 7.30E-01 3.75E+00
Influenza 1E30 Whole blood 1.35E-04 -1.88E+00 -1.24E+01
Interstitial cystitis GC00.3 Bladder tissue 4.79E-01 2.35E-01 5.27E-01
Intracranial aneurysm 8B01.0 Intracranial artery 7.84E-06 2.25E+00 5.87E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.85E-01 -3.98E-02 -1.19E-01
Ischemic stroke 8B11 Peripheral blood 5.96E-01 -1.56E-01 -3.44E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.12E-11 5.27E-01 1.01E+00
Lateral sclerosis 8B60.4 Skin 9.81E-01 -7.43E-02 -1.16E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 4.40E-01 2.02E-02 2.71E-02
Liver cancer 2C12.0 Liver tissue 3.93E-13 1.21E+00 1.79E+00
Liver failure DB99.7-DB99.8 Liver tissue 4.39E-04 1.92E+00 2.73E+00
Lung cancer 2C25 Lung tissue 4.25E-01 7.30E-02 1.26E-01
Lupus erythematosus 4A40 Whole blood 1.08E-01 1.18E-01 1.92E-01
Major depressive disorder 6A70-6A7Z Hippocampus 1.59E-01 -5.46E-02 -2.30E-01
Major depressive disorder 6A70-6A7Z Whole blood 6.06E-01 6.47E-02 1.05E-01
Melanoma 2C30 Skin 8.62E-02 9.17E-01 6.03E-01
Multiple myeloma 2A83.1 Peripheral blood 6.05E-01 -2.88E-01 -1.81E-01
Multiple myeloma 2A83.1 Bone marrow 1.23E-02 4.60E-01 1.19E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.78E-01 -1.22E-01 -3.27E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.53E-01 2.26E-01 6.22E-01
Myelofibrosis 2A20.2 Whole blood 5.31E-02 9.74E-01 2.83E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.51E-03 5.22E-01 7.38E-01
Myopathy 8C70.6 Muscle tissue 1.03E-03 7.58E-01 2.13E+00
Neonatal sepsis KA60 Whole blood 6.28E-40 1.30E+00 3.28E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.54E-03 4.58E-01 9.80E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 4.55E-01 6.53E-02 1.55E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.25E-01 -6.39E-02 -1.91E-01
Olive pollen allergy CA08.00 Peripheral blood 5.24E-01 -3.64E-01 -5.01E-01
Oral cancer 2B6E Oral tissue 5.97E-13 1.63E+00 2.44E+00
Osteoarthritis FA00-FA0Z Synovial tissue 5.04E-01 -4.27E-03 -3.37E-03
Osteoporosis FB83.1 Bone marrow 7.92E-01 3.84E-02 1.69E-01
Ovarian cancer 2C73 Ovarian tissue 4.65E-03 1.25E+00 1.26E+00
Pancreatic cancer 2C10 Pancreas 4.92E-02 -1.08E+00 -7.79E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.96E-02 -7.41E-01 -8.78E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.78E-06 7.20E-01 2.13E+00
Pituitary cancer 2D12 Pituitary tissue 1.76E-12 -3.53E+00 -5.25E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.81E-08 -4.36E+00 -5.81E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.28E-01 5.64E-02 2.14E-01
Polycythemia vera 2A20.4 Whole blood 1.22E-02 1.84E-01 5.15E-01
Pompe disease 5C51.3 Biceps muscle 8.17E-01 4.89E-05 1.57E-04
Preterm birth KA21.4Z Myometrium 3.30E-02 -4.68E-01 -1.46E+00
Prostate cancer 2C82 Prostate 5.18E-02 -1.03E-01 -1.06E-01
Psoriasis EA90 Skin 7.84E-08 -6.11E-01 -7.67E-01
Rectal cancer 2B92 Rectal colon tissue 3.58E-02 2.92E-01 8.55E-01
Renal cancer 2C90-2C91 Kidney 2.73E-02 1.10E+00 9.65E-01
Retinoblastoma 2D02.2 Uvea 3.46E-06 -2.25E+00 -4.13E+00
Rheumatoid arthritis FA20 Synovial tissue 4.01E-01 9.41E-02 8.63E-02
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.56E-01 1.13E-01 1.53E-01
Schizophrenia 6A20 Prefrontal cortex 1.23E-01 -1.29E-01 -2.84E-01
Schizophrenia 6A20 Superior temporal cortex 4.25E-01 1.46E-02 6.88E-02
Scleroderma 4A42.Z Whole blood 5.67E-02 4.02E-01 8.96E-01
Seizure 8A60-8A6Z Whole blood 3.40E-01 5.92E-02 2.17E-01
Sensitive skin EK0Z Skin 4.23E-01 -4.74E-02 -3.92E-01
Sepsis with septic shock 1G41 Whole blood 1.73E-82 1.01E+00 2.45E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.38E-02 -1.44E-01 -5.11E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.78E-02 3.34E-01 9.50E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 6.11E-01 1.77E-01 2.06E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.07E-01 2.93E-01 5.43E-01
Skin cancer 2C30-2C3Z Skin 7.39E-07 1.21E-01 1.66E-01
Thrombocythemia 3B63 Whole blood 1.19E-01 3.71E-02 1.08E-01
Thrombocytopenia 3B64 Whole blood 9.15E-01 1.47E-02 4.05E-02
Thyroid cancer 2D10 Thyroid 4.18E-31 1.11E+00 2.06E+00
Tibial muscular dystrophy 8C75 Muscle tissue 2.31E-10 1.52E+00 3.85E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.28E-02 -1.87E-01 -1.42E+00
Type 2 diabetes 5A11 Liver tissue 2.47E-01 2.66E-02 1.56E-01
Ureter cancer 2C92 Urothelium 8.63E-01 -7.26E-02 -1.60E-01
Uterine cancer 2C78 Endometrium tissue 7.21E-03 2.62E-01 2.25E-01
Vitiligo ED63.0 Skin 4.63E-01 -5.47E-03 -9.32E-03
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Branched-chain-amino-acid transaminase 1 (BCAT1) DTT Info
DME DTT Type Literature-reported

References

1 Purification, crystallization and preliminary X-ray crystallographic analysis of branched-chain aminotransferase from Deinococcus radiodurans. Acta Crystallogr Sect F Struct Biol Cryst Commun. 2007 Jun 1;63(Pt 6):492-4.