General Information of Drug-Metabolizing Enzyme (DME) (ID: DEA3VM1)

DME Name Phosphoglucomutase 1 (PGM1)
Synonyms Glucose phosphomutase 1; Phosphoglucomutase-1; PGM 1; PGM1
Gene Name PGM1
UniProt ID
PGM1_HUMAN
INTEDE ID
DME0146
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
5236
EC Number EC: 5.4.2.2
Isomerase
Mutase
Phosphomutase
EC: 5.4.2.2
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MVKIVTVKTQAYQDQKPGTSGLRKRVKVFQSSANYAENFIQSIISTVEPAQRQEATLVVG
GDGRFYMKEAIQLIARIAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNP
GGPNGDFGIKFNISNGGPAPEAITDKIFQISKTIEEYAVCPDLKVDLGVLGKQQFDLENK
FKPFTVEIVDSVEAYATMLRSIFDFSALKELLSGPNRLKIRIDAMHGVVGPYVKKILCEE
LGAPANSAVNCVPLEDFGGHHPDPNLTYAADLVETMKSGEHDFGAAFDGDGDRNMILGKH
GFFVNPSDSVAVIAANIFSIPYFQQTGVRGFARSMPTSGALDRVASATKIALYETPTGWK
FFGNLMDASKLSLCGEESFGTGSDHIREKDGLWAVLAWLSILATRKQSVEDILKDHWQKY
GRNFFTRYDYEEVEAEGANKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYSDPV
DGSISRNQGLRLIFTDGSRIVFRLSGTGSAGATIRLYIDSYEKDVAKINQDPQVMLAPLI
SIALKVSQLQERTGRTAPTVIT
Function This enzyme participates in both the breakdown and synthesis of glucose.
KEGG Pathway
Amino sugar and nucleotide sugar metabolism (hsa00520 )
Galactose metabolism (hsa00052 )
Glycolysis / Gluconeogenesis (hsa00010 )
Metabolic pathways (hsa01100 )
Pentose phosphate pathway (hsa00030 )
Purine metabolism (hsa00230 )
Starch and sucrose metabolism (hsa00500 )
Reactome Pathway
Glycogen synthesis (R-HSA-3322077 )
Neutrophil degranulation (R-HSA-6798695 )
Defective PGM1 causes PGM1-CDG (CDG1t) (R-HSA-5609974 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Human calcitonin DM0WD1V N. A. N. A. Phase 4 [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.87E-16 -6.27E-01 -1.10E+00
Alopecia ED70 Skin from scalp 1.53E-03 1.43E-01 6.15E-01
Alzheimer's disease 8A20 Entorhinal cortex 6.72E-02 4.56E-02 1.63E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.18E-01 3.21E-01 8.53E-01
Aortic stenosis BB70 Calcified aortic valve 9.68E-01 8.71E-02 6.14E-02
Apnea 7A40 Hyperplastic tonsil 9.97E-01 7.76E-02 1.23E-01
Arthropathy FA00-FA5Z Peripheral blood 2.19E-01 1.07E-01 5.96E-01
Asthma CA23 Nasal and bronchial airway 1.36E-05 3.35E-01 4.75E-01
Atopic dermatitis EA80 Skin 5.30E-01 -1.44E-01 -4.60E-01
Autism 6A02 Whole blood 7.69E-01 1.01E-01 3.24E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.14E-01 1.77E-01 4.94E-01
Autosomal dominant monocytopenia 4B04 Whole blood 6.15E-01 1.37E-01 2.68E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.75E-01 7.82E-02 3.25E-01
Batten disease 5C56.1 Whole blood 8.34E-01 -9.60E-03 -4.60E-02
Behcet's disease 4A62 Peripheral blood 7.76E-01 1.52E-02 7.70E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.23E-02 6.91E-02 3.31E-01
Bladder cancer 2C94 Bladder tissue 1.13E-04 -4.86E-01 -1.93E+00
Breast cancer 2C60-2C6Z Breast tissue 2.35E-60 -9.86E-01 -1.25E+00
Cardioembolic stroke 8B11.20 Whole blood 2.69E-04 3.29E-01 1.15E+00
Cervical cancer 2C77 Cervical tissue 9.40E-02 -1.33E-01 -2.76E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.58E-01 3.44E-02 7.15E-02
Chronic hepatitis C 1E51.1 Whole blood 1.60E-02 -2.41E-01 -1.19E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 1.50E-01 -1.08E-01 -3.20E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.39E-01 8.85E-02 3.20E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.19E-02 -1.26E-01 -3.53E-01
Colon cancer 2B90 Colon tissue 6.19E-166 -1.23E+00 -4.57E+00
Coronary artery disease BA80-BA8Z Peripheral blood 2.20E-01 6.76E-01 6.42E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.98E-01 1.09E-01 1.95E-01
Endometriosis GA10 Endometrium tissue 3.91E-03 1.17E-01 4.04E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.73E-01 -1.20E-01 -6.24E-01
Familial hypercholesterolemia 5C80.00 Whole blood 4.68E-01 1.59E-01 5.09E-01
Gastric cancer 2B72 Gastric tissue 1.99E-02 1.70E-01 4.76E+00
Glioblastopma 2A00.00 Nervous tissue 3.57E-11 2.43E-01 6.22E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 4.48E-05 6.21E-01 1.03E+01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.15E-05 1.33E+00 2.19E+00
Head and neck cancer 2D42 Head and neck tissue 3.55E-01 1.18E-01 1.66E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.39E-01 2.00E-02 4.86E-02
Huntington's disease 8A01.10 Whole blood 1.37E-01 -2.49E-01 -4.78E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.56E-01 1.82E-01 4.12E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.16E-01 -9.13E-02 -7.11E-01
Influenza 1E30 Whole blood 3.46E-02 4.97E-01 2.73E+00
Interstitial cystitis GC00.3 Bladder tissue 1.73E-01 -2.08E-01 -8.52E-01
Intracranial aneurysm 8B01.0 Intracranial artery 9.37E-01 2.86E-01 4.47E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.33E-02 -8.93E-02 -3.66E-01
Ischemic stroke 8B11 Peripheral blood 9.74E-02 -1.15E-01 -7.10E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.97E-02 -2.02E-01 -3.79E-01
Lateral sclerosis 8B60.4 Skin 5.35E-02 -2.86E-01 -1.68E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 3.66E-01 -7.78E-02 -6.45E-02
Liver cancer 2C12.0 Liver tissue 3.59E-39 -1.07E+00 -3.37E+00
Liver failure DB99.7-DB99.8 Liver tissue 2.01E-04 -2.29E+00 -7.29E+00
Lung cancer 2C25 Lung tissue 1.08E-25 -3.39E-01 -9.24E-01
Lupus erythematosus 4A40 Whole blood 4.69E-08 1.92E-01 5.66E-01
Major depressive disorder 6A70-6A7Z Hippocampus 3.41E-01 -6.68E-02 -3.26E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.16E-02 5.96E-02 2.17E-01
Melanoma 2C30 Skin 7.59E-03 -3.42E-01 -6.66E-01
Multiple myeloma 2A83.1 Peripheral blood 8.85E-01 -6.83E-02 -2.10E-01
Multiple myeloma 2A83.1 Bone marrow 4.79E-05 1.03E+00 2.66E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.44E-03 -6.16E-01 -1.80E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.01E-01 1.43E-01 5.26E-01
Myelofibrosis 2A20.2 Whole blood 1.33E-02 -4.15E-01 -2.30E+00
Myocardial infarction BA41-BA50 Peripheral blood 3.41E-01 -1.28E-02 -2.49E-02
Myopathy 8C70.6 Muscle tissue 2.62E-06 -3.91E-01 -3.29E+00
Neonatal sepsis KA60 Whole blood 2.77E-19 7.06E-01 1.75E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.19E-03 4.08E-01 1.47E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.66E-01 2.73E-01 6.44E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.20E-01 3.21E-01 8.74E-01
Olive pollen allergy CA08.00 Peripheral blood 8.36E-01 -8.47E-02 -1.25E-01
Oral cancer 2B6E Oral tissue 1.85E-01 -7.52E-02 -7.10E-02
Osteoarthritis FA00-FA0Z Synovial tissue 6.33E-01 -9.76E-01 -7.69E-01
Osteoporosis FB83.1 Bone marrow 7.73E-02 -2.69E-01 -1.33E+00
Ovarian cancer 2C73 Ovarian tissue 2.00E-01 -6.92E-01 -7.37E-01
Pancreatic cancer 2C10 Pancreas 3.43E-01 -1.88E-01 -2.44E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 3.85E-01 7.77E-02 2.83E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.39E-03 1.05E-01 5.43E-01
Pituitary cancer 2D12 Pituitary tissue 1.63E-05 -3.75E-01 -1.58E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.45E-04 -4.13E-01 -1.89E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.11E-02 3.85E-02 2.38E-01
Polycythemia vera 2A20.4 Whole blood 4.28E-01 5.39E-02 2.77E-01
Pompe disease 5C51.3 Biceps muscle 6.27E-04 -6.07E-01 -2.67E+00
Preterm birth KA21.4Z Myometrium 2.20E-01 -4.35E-01 -1.22E+00
Prostate cancer 2C82 Prostate 7.74E-03 -2.19E-01 -5.81E-01
Psoriasis EA90 Skin 3.86E-18 -2.91E-01 -9.87E-01
Rectal cancer 2B92 Rectal colon tissue 4.20E-33 -1.23E+00 -2.90E+01
Renal cancer 2C90-2C91 Kidney 9.72E-02 3.70E-01 8.84E-01
Retinoblastoma 2D02.2 Uvea 2.29E-01 -4.42E-01 -2.71E+00
Rheumatoid arthritis FA20 Synovial tissue 6.47E-01 1.10E-01 9.54E-02
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.62E-01 5.00E-02 2.51E-01
Schizophrenia 6A20 Prefrontal cortex 6.85E-02 -7.96E-02 -3.19E-01
Schizophrenia 6A20 Superior temporal cortex 8.03E-01 -3.55E-02 -1.90E-01
Scleroderma 4A42.Z Whole blood 7.64E-01 -2.93E-02 -1.30E-01
Seizure 8A60-8A6Z Whole blood 7.47E-01 -1.74E-02 -4.54E-02
Sensitive skin EK0Z Skin 2.43E-01 -6.87E-02 -3.28E-01
Sepsis with septic shock 1G41 Whole blood 6.46E-48 7.54E-01 1.81E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.18E-02 -3.91E-01 -1.45E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.24E-02 -1.81E-01 -5.88E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 6.97E-01 1.06E-01 3.97E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.77E-01 1.42E-01 6.45E-01
Skin cancer 2C30-2C3Z Skin 1.32E-07 -2.16E-01 -6.15E-01
Thrombocythemia 3B63 Whole blood 1.49E-01 -1.48E-01 -8.06E-01
Thrombocytopenia 3B64 Whole blood 5.50E-01 -9.88E-02 -1.91E-01
Thyroid cancer 2D10 Thyroid 2.17E-02 9.06E-02 3.81E-01
Tibial muscular dystrophy 8C75 Muscle tissue 7.16E-09 -5.53E-01 -3.13E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.50E-02 2.94E-01 2.16E+00
Type 2 diabetes 5A11 Liver tissue 5.62E-01 -7.58E-02 -4.02E-01
Ureter cancer 2C92 Urothelium 9.60E-01 -1.05E-01 -2.54E-01
Uterine cancer 2C78 Endometrium tissue 7.04E-02 -1.91E-02 -3.71E-02
Vitiligo ED63.0 Skin 6.79E-01 -8.14E-02 -4.49E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Renal metabolism of calcitonin. Am J Physiol. 1988 Apr;254(4 Pt 2):F593-600.