Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEB7I4M)

DME Name UDP-glucuronosyltransferase 2B28 (UGT2B28)
Synonyms UDP-glucuronosyltransferase family 2 member B28; UDPGT 2B28; UGT2B28
Gene Name UGT2B28
UniProt ID
UDB28_HUMAN
INTEDE ID
DME0638
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
54490
EC Number EC: 2.4.1.17
Transferase
Glycosyltransferases
Hexosyltransferase
EC: 2.4.1.17
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MALKWTSVLLLIHLGCYFSSGSCGKVLVWTGEYSHWMNMKTILKELVQRGHEVTVLASSA
SILFDPNDAFTLKLEVYPTSLTKTEFENIIMQQVKRWSDIQKDSFWLYFSQEQEILWEFH
DIFRNFCKDVVSNKKVMKKLQESRFDIIFADAFFPCGELLAALLNIPFVYSLCFTPGYTI
ERHSGGLIFPPSYIPVVMSKLSDQMTFMERVKNMIYVLYFDFWFQMCDMKKWDQFYSEVL
GRPTTLFETMGKADIWLMRNSWSFQFPHPFLPNIDFVGGLHCKPAKPLPKEMEEFVQSSG
ENGVVVFSLGSVISNMTAERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQN
DLLGLPKTRAFITHGGANGIYEAIYHGIPMVGIPLFWDQPDNIAHMKAKGAAVRLDFHTM
SSTDLLNALKTVINDPSYKENVMKLSIIQHDQPVKPLHRAVFWIEFVMCHKGAKHLRVAA
RDLTWFQYHSLDVIGFLLACVATVIFVVTKFCLFCFWKFARKGKKGKRD
Function
This enzyme is important in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isozyme has glucuronidating capacity with steroid substrates such as 5-beta-androstane 3-alpha,17-beta-diol, estradiol, ADT, eugenol and bile acids.
KEGG Pathway
Ascorbate and aldarate metabolism (hsa00053 )
Chemical carcinogenesis (hsa05204 )
Drug metabolism - cytochrome P450 (hsa00982 )
Drug metabolism - other enzymes (hsa00983 )
Metabolic pathways (hsa01100 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Pentose and glucuronate interconversions (hsa00040 )
Porphyrin and chlorophyll metabolism (hsa00860 )
Retinol metabolism (hsa00830 )
Steroid hormone biosynthesis (hsa00140 )
Reactome Pathway
Glucuronidation (R-HSA-156588 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Estradiol DMUNTE3 Acne vulgaris ED80 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.54E-02 7.52E-03 2.58E-02
Alzheimer's disease 8A20 Entorhinal cortex 7.34E-01 -8.14E-03 -4.54E-02
Asthma CA23 Nasal and bronchial airway 9.86E-01 1.62E-02 2.71E-02
Behcet's disease 4A62 Peripheral blood 4.68E-02 2.59E-01 1.14E+00
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.55E-01 -4.44E-02 -2.45E-01
Bladder cancer 2C94 Bladder tissue 6.76E-03 4.07E-01 1.10E+00
Breast cancer 2C60-2C6Z Breast tissue 7.28E-13 -1.22E+00 -5.26E-01
Colon cancer 2B90 Colon tissue 4.10E-58 -1.28E+00 -2.18E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.94E-01 4.79E-03 1.66E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.77E-01 -1.01E-01 -5.16E-01
Gastric cancer 2B72 Gastric tissue 3.07E-01 -8.18E-02 -1.78E-01
Glioblastopma 2A00.00 Nervous tissue 1.88E-18 2.24E-01 6.62E-01
Head and neck cancer 2D42 Head and neck tissue 2.37E-09 -2.26E-01 -8.18E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.60E-03 -1.47E-01 -7.94E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.94E-01 5.15E-02 1.90E-01
Interstitial cystitis GC00.3 Bladder tissue 1.31E-01 -3.11E-01 -1.36E+00
Ischemic stroke 8B11 Peripheral blood 4.74E-01 3.06E-02 1.36E-01
Liver cancer 2C12.0 Liver tissue 1.14E-14 -8.25E-01 -1.26E+00
Liver failure DB99.7-DB99.8 Liver tissue 8.46E-02 -1.67E+00 -2.76E+00
Lung cancer 2C25 Lung tissue 2.42E-18 7.76E-02 2.57E-01
Lupus erythematosus 4A40 Whole blood 1.35E-10 1.38E-01 3.56E-01
Major depressive disorder 6A70-6A7Z Hippocampus 1.73E-01 4.60E-02 2.46E-01
Multiple myeloma 2A83.1 Bone marrow 9.61E-03 -4.77E-01 -1.34E+00
Multiple myeloma 2A83.1 Peripheral blood 3.03E-01 5.71E-02 4.18E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.31E-01 8.42E-02 2.88E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.52E-01 4.17E-02 1.45E-01
Myocardial infarction BA41-BA50 Peripheral blood 2.18E-01 1.22E-01 8.57E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 9.85E-03 -3.40E-01 -1.42E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.88E-01 8.29E-02 2.20E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.37E-01 5.98E-02 5.71E-01
Olive pollen allergy CA08.00 Peripheral blood 9.03E-02 1.11E-01 8.67E-01
Oral cancer 2B6E Oral tissue 3.68E-02 -2.57E-01 -2.01E-01
Ovarian cancer 2C73 Ovarian tissue 3.79E-02 1.33E+00 1.19E+00
Pancreatic cancer 2C10 Pancreas 1.14E-02 -9.97E-01 -1.22E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 9.40E-01 -3.10E-02 -1.51E-01
Pituitary cancer 2D12 Pituitary tissue 9.71E-02 -2.39E-01 -4.59E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.20E-01 3.77E-02 2.13E-01
Pompe disease 5C51.3 Biceps muscle 1.96E-02 -2.91E-01 -1.61E+00
Prostate cancer 2C82 Prostate 5.87E-01 -4.23E-02 -4.26E-02
Psoriasis EA90 Skin 1.57E-07 -3.34E-01 -3.99E-01
Rectal cancer 2B92 Rectal colon tissue 1.76E-03 -1.45E+00 -2.55E+00
Renal cancer 2C90-2C91 Kidney 2.79E-02 -8.26E-01 -5.94E-01
Retinoblastoma 2D02.2 Uvea 8.89E-02 1.35E-01 7.59E-01
Schizophrenia 6A20 Prefrontal cortex 2.08E-01 7.34E-02 2.08E-01
Schizophrenia 6A20 Superior temporal cortex 4.52E-01 -1.41E-02 -1.13E-01
Scleroderma 4A42.Z Whole blood 3.67E-02 1.55E-01 5.81E-01
Seizure 8A60-8A6Z Whole blood 9.70E-01 8.18E-03 3.07E-02
Sepsis with septic shock 1G41 Whole blood 6.72E-01 4.83E-02 1.87E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.27E-01 4.49E-01 8.39E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.28E-02 2.06E-01 1.61E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 9.38E-01 6.59E-02 3.19E-01
Skin cancer 2C30-2C3Z Skin 1.45E-02 -6.06E-02 -5.84E-02
Thrombocythemia 3B63 Whole blood 4.44E-01 1.33E-01 8.00E-01
Thrombocytopenia 3B64 Whole blood 6.69E-02 7.92E-01 1.95E+00
Thyroid cancer 2D10 Thyroid 2.58E-30 -1.24E+00 -1.67E+00
Tibial muscular dystrophy 8C75 Muscle tissue 1.32E-01 7.75E-02 5.24E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.12E-02 3.79E-01 4.16E+00
Type 2 diabetes 5A11 Liver tissue 9.16E-01 -3.09E-02 -1.47E-01
Ureter cancer 2C92 Urothelium 9.51E-01 7.88E-02 1.99E-01
Uterine cancer 2C78 Endometrium tissue 1.10E-16 -1.14E+00 -1.32E+00
Vitiligo ED63.0 Skin 4.27E-01 -1.58E-01 -1.40E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 61 Diseases

References

1 Isolation and characterization of the UGT2B28 cDNA encoding a novel human steroid conjugating UDP-glucuronosyltransferase. Biochemistry. 2001 Apr 3;40(13):3869-81.