General Information of Drug-Metabolizing Enzyme (DME) (ID: DEBH7ND)

DME Name Chondroitin sulfate glucuronyltransferase (CHPF2)
Synonyms
Chondroitin glucuronyltransferase; Chondroitin polymerizing factor 2; Chondroitin synthase 3; N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase; UNQ299/PRO339; CHPF2; CHSY3; CSGLCAT; CSGlcA-T; ChPF-2; ChSy-3; KIAA1402
Gene Name CHPF2
UniProt ID
CHPF2_HUMAN
INTEDE ID
DME0490
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
54480
EC Number EC: 2.4.1.226
Transferase
Glycosyltransferases
Hexosyltransferase
EC: 2.4.1.226
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MRLSSLLALLRPALPLILGLSLGCSLSLLRVSWIQGEGEDPCVEAVGERGGPQNPDSRAR
LDQSDEDFKPRIVPYYRDPNKPYKKVLRTRYIQTELGSRERLLVAVLTSRATLSTLAVAV
NRTVAHHFPRLLYFTGQRGARAPAGMQVVSHGDERPAWLMSETLRHLHTHFGADYDWFFI
MQDDTYVQAPRLAALAGHLSINQDLYLGRAEEFIGAGEQARYCHGGFGYLLSRSLLLRLR
PHLDGCRGDILSARPDEWLGRCLIDSLGVGCVSQHQGQQYRSFELAKNRDPEKEGSSAFL
SAFAVHPVSEGTLMYRLHKRFSALELERAYSEIEQLQAQIRNLTVLTPEGEAGLSWPVGL
PAPFTPHSRFEVLGWDYFTEQHTFSCADGAPKCPLQGASRADVGDALETALEQLNRRYQP
RLRFQKQRLLNGYRRFDPARGMEYTLDLLLECVTQRGHRRALARRVSLLRPLSRVEILPM
PYVTEATRVQLVLPLLVAEAAAAPAFLEAFAANVLEPREHALLTLLLVYGPREGGRGAPD
PFLGVKAAAAELERRYPGTRLAWLAVRAEAPSQVRLMDVVSKKHPVDTLFFLTTVWTRPG
PEVLNRCRMNAISGWQAFFPVHFQEFNPALSPQRSPPGPPGAGPDPPSPPGADPSRGAPI
GGRFDRQASAEGCFYNADYLAARARLAGELAGQEEEEALEGLEVMDVFLRFSGLHLFRAV
EPGLVQKFSLRDCSPRLSEELYHRCRLSNLEGLGGRAQLAMALFEQEQANST
Function This enzyme transfers glucuronic acid (GlcUA) from UDP-GlcUA to N- acetylgalactosamine residues on the non-reducing end of the elongating chondroitin polymer.
KEGG Pathway
Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate (hsa00532 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Chondroitin sulfate biosynthesis (R-HSA-2022870 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
UDP-glucuronic acid DMW16X2 Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
UDP-glucuronic acid Discovery agent [N.A.] Investigative Km = 0.0824 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 9.83E-36 5.18E-01 1.85E+00
Alopecia ED70 Skin from scalp 8.93E-01 2.70E-02 5.85E-02
Alzheimer's disease 8A20 Entorhinal cortex 1.23E-05 -1.53E-01 -7.48E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.29E-01 1.74E-02 7.50E-02
Aortic stenosis BB70 Calcified aortic valve 3.44E-01 2.91E-01 3.79E-01
Apnea 7A40 Hyperplastic tonsil 5.00E-01 -1.69E-01 -6.24E-01
Arthropathy FA00-FA5Z Peripheral blood 5.21E-01 7.52E-02 4.56E-01
Asthma CA23 Nasal and bronchial airway 6.96E-01 -5.02E-02 -1.21E-01
Atopic dermatitis EA80 Skin 1.19E-06 3.47E-01 1.49E+00
Autism 6A02 Whole blood 1.53E-04 1.75E-01 8.74E-01
Autoimmune uveitis 9A96 Peripheral monocyte 9.58E-01 2.31E-01 8.24E-01
Autosomal dominant monocytopenia 4B04 Whole blood 3.27E-02 -2.54E-01 -7.94E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.59E-16 4.98E-01 1.62E+00
Batten disease 5C56.1 Whole blood 1.28E-01 2.70E-01 1.21E+00
Behcet's disease 4A62 Peripheral blood 2.58E-01 5.18E-03 4.80E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.77E-02 -9.67E-02 -6.75E-01
Bladder cancer 2C94 Bladder tissue 3.99E-06 6.50E-01 3.53E+00
Breast cancer 2C60-2C6Z Breast tissue 2.98E-79 4.85E-01 1.62E+00
Cardioembolic stroke 8B11.20 Whole blood 2.89E-16 9.01E-01 3.69E+00
Cervical cancer 2C77 Cervical tissue 5.91E-01 1.67E-01 3.74E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.90E-01 -1.59E-02 -2.62E-02
Chronic hepatitis C 1E51.1 Whole blood 7.74E-03 -1.90E-01 -1.45E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 9.18E-02 -2.24E-01 -5.49E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.17E-03 1.15E-01 3.91E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.41E-02 1.05E-01 8.97E-01
Colon cancer 2B90 Colon tissue 6.40E-18 2.19E-01 8.62E-01
Coronary artery disease BA80-BA8Z Peripheral blood 5.17E-06 6.67E-01 5.26E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.82E-01 1.28E-01 2.19E-01
Endometriosis GA10 Endometrium tissue 5.63E-01 -1.89E-02 -2.84E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.69E-01 4.03E-02 3.15E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.60E-13 5.66E-01 2.23E+00
Gastric cancer 2B72 Gastric tissue 8.39E-02 6.69E-01 1.89E+00
Glioblastopma 2A00.00 Nervous tissue 1.58E-52 2.67E-01 7.70E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.21E-01 -4.00E-01 -8.13E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.44E-06 1.17E+00 2.32E+00
Head and neck cancer 2D42 Head and neck tissue 3.69E-27 5.58E-01 1.78E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.89E-01 4.23E-02 1.60E-01
Huntington's disease 8A01.10 Whole blood 4.76E-01 8.48E-02 7.19E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.56E-01 7.52E-02 8.25E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.23E-01 -2.56E-02 -1.60E-01
Influenza 1E30 Whole blood 1.17E-01 -6.52E-01 -1.52E+00
Interstitial cystitis GC00.3 Bladder tissue 3.77E-04 7.29E-01 3.37E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.26E-08 9.89E-01 3.47E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.50E-01 -2.79E-02 -7.36E-02
Ischemic stroke 8B11 Peripheral blood 8.10E-01 3.02E-03 2.24E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 9.12E-02 1.04E-01 2.97E-01
Lateral sclerosis 8B60.4 Skin 3.26E-01 -8.27E-02 -1.79E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 4.18E-01 2.74E-01 8.50E-01
Liver cancer 2C12.0 Liver tissue 6.50E-05 2.41E-01 7.10E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.20E-01 1.74E-01 3.84E-01
Lung cancer 2C25 Lung tissue 1.54E-64 5.30E-01 2.02E+00
Lupus erythematosus 4A40 Whole blood 6.81E-01 -1.47E-01 -3.16E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.28E-01 -3.22E-02 -2.49E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.52E-02 1.12E-01 4.33E-01
Melanoma 2C30 Skin 2.49E-01 2.68E-01 3.25E-01
Multiple myeloma 2A83.1 Peripheral blood 7.35E-01 6.07E-02 3.05E-01
Multiple myeloma 2A83.1 Bone marrow 9.51E-04 4.99E-01 1.59E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.80E-01 -2.73E-01 -8.52E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 6.50E-01 1.92E-01 4.94E-01
Myelofibrosis 2A20.2 Whole blood 6.21E-02 -1.27E-01 -1.28E+00
Myocardial infarction BA41-BA50 Peripheral blood 6.73E-01 1.25E-01 2.34E-01
Myopathy 8C70.6 Muscle tissue 1.83E-03 4.53E-01 1.96E+00
Neonatal sepsis KA60 Whole blood 3.20E-07 2.45E-01 6.98E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.01E-30 9.15E-01 1.23E+01
Non-alcoholic fatty liver disease DB92 Liver tissue 2.41E-01 -4.76E-02 -2.22E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.60E-01 -8.92E-02 -7.95E-01
Olive pollen allergy CA08.00 Peripheral blood 8.31E-02 -2.79E-01 -1.32E+00
Oral cancer 2B6E Oral tissue 2.44E-04 5.11E-01 1.14E+00
Osteoarthritis FA00-FA0Z Synovial tissue 1.29E-01 7.47E-01 7.44E-01
Osteoporosis FB83.1 Bone marrow 2.15E-01 -2.57E-01 -9.09E-01
Ovarian cancer 2C73 Ovarian tissue 2.76E-03 6.11E-01 1.34E+00
Pancreatic cancer 2C10 Pancreas 3.26E-02 2.34E-01 5.51E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.95E-03 -2.17E-01 -1.38E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.26E-03 1.34E-01 8.27E-01
Pituitary cancer 2D12 Pituitary tissue 3.41E-03 -4.01E-01 -1.93E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.16E-06 -5.59E-01 -2.82E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.04E-01 9.59E-02 3.61E-01
Polycythemia vera 2A20.4 Whole blood 7.92E-03 -9.71E-02 -9.05E-01
Pompe disease 5C51.3 Biceps muscle 1.46E-04 5.41E-01 2.00E+00
Preterm birth KA21.4Z Myometrium 2.03E-01 -2.12E-04 -9.82E-04
Prostate cancer 2C82 Prostate 2.07E-01 2.17E-01 4.95E-01
Psoriasis EA90 Skin 9.68E-09 2.28E-01 6.93E-01
Rectal cancer 2B92 Rectal colon tissue 8.12E-01 -9.78E-03 -4.32E-02
Renal cancer 2C90-2C91 Kidney 2.65E-06 6.10E-01 2.33E+00
Retinoblastoma 2D02.2 Uvea 5.42E-05 7.67E-01 4.58E+00
Rheumatoid arthritis FA20 Synovial tissue 8.71E-08 8.98E-01 4.93E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.23E-01 -3.63E-02 -2.65E-01
Schizophrenia 6A20 Prefrontal cortex 4.91E-01 -3.88E-02 -6.96E-02
Schizophrenia 6A20 Superior temporal cortex 4.34E-01 6.75E-03 5.62E-02
Scleroderma 4A42.Z Whole blood 4.08E-01 6.72E-02 5.40E-01
Seizure 8A60-8A6Z Whole blood 9.12E-01 3.74E-03 1.49E-02
Sensitive skin EK0Z Skin 4.20E-01 2.97E-02 2.30E-01
Sepsis with septic shock 1G41 Whole blood 3.23E-11 2.07E-01 7.20E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.08E-02 -1.82E-01 -3.84E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.78E-03 2.60E-01 1.14E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 9.19E-01 1.50E-01 3.96E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.41E-01 8.94E-02 3.19E-01
Skin cancer 2C30-2C3Z Skin 1.90E-47 5.86E-01 1.92E+00
Thrombocythemia 3B63 Whole blood 2.44E-03 -1.21E-01 -1.18E+00
Thrombocytopenia 3B64 Whole blood 7.41E-01 1.26E-01 1.31E-01
Thyroid cancer 2D10 Thyroid 5.20E-31 4.90E-01 1.74E+00
Tibial muscular dystrophy 8C75 Muscle tissue 6.91E-02 2.36E-01 7.10E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.45E-01 -1.71E-01 -1.12E+00
Type 2 diabetes 5A11 Liver tissue 3.95E-01 -4.96E-03 -1.76E-02
Ureter cancer 2C92 Urothelium 2.99E-01 1.07E-01 4.04E-01
Uterine cancer 2C78 Endometrium tissue 9.76E-06 -1.26E-01 -1.88E-01
Vitiligo ED63.0 Skin 1.62E-01 -1.27E-01 -9.20E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Molecular cloning and characterization of a novel chondroitin sulfate glucuronyltransferase that transfers glucuronic acid to N-acetylgalactosamine. J Biol Chem. 2002 Oct 11;277(41):38179-88.