General Information of Drug-Metabolizing Enzyme (DME) (ID: DEBMFZ8)

DME Name Estradiol 17-beta-dehydrogenase 2 (HSD17B2)
Synonyms
Testosterone 17-beta-dehydrogenase; Microsomal 17-beta-hydroxysteroid dehydrogenase; Short chain dehydrogenase/reductase family 9C member 2; 17-beta-HSD 2; 17-beta-hydroxysteroid dehydrogenase type 2; E2DH; EDH17B2; HSD17B2; SDR9C2
Gene Name HSD17B2
UniProt ID
DHB2_HUMAN
INTEDE ID
DME0422
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
3294
EC Number EC: 1.1.1.62
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.62
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLIL
FSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPG
AEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELL
LMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVT
MFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYI
LAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYD
YFAKRHFGQDKPMPRALRMPNYKKKAT
Function This enzyme is capable of catalyzing the interconversion of testosterone and androstenedione, as well as estradiol and estrone. It also has 20-alpha- HSD activity.
KEGG Pathway
Metabolic pathways (hsa01100 )
Ovarian steroidogenesis (hsa04913 )
Steroid hormone biosynthesis (hsa00140 )
Reactome Pathway
Estrogen biosynthesis (R-HSA-193144 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
2 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Estrone DM5T6US Acne vulgaris ED80 Approved [1]
Prasterone DM67VKL Chronic obstructive pulmonary disease CA22 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.87E-01 2.71E-02 1.69E-01
Alopecia ED70 Skin from scalp 2.42E-02 -1.62E-01 -3.46E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.98E-02 -3.85E-02 -2.11E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.89E-01 -8.64E-02 -9.43E-01
Aortic stenosis BB70 Calcified aortic valve 8.66E-01 -2.11E-01 -5.30E-01
Apnea 7A40 Hyperplastic tonsil 8.27E-03 1.80E+00 2.80E+00
Arthropathy FA00-FA5Z Peripheral blood 8.78E-01 -1.95E-02 -1.28E-01
Asthma CA23 Nasal and bronchial airway 1.25E-03 9.19E-01 5.69E-01
Atopic dermatitis EA80 Skin 1.18E-02 6.14E-01 6.32E-01
Autism 6A02 Whole blood 9.27E-02 -7.97E-02 -5.41E-01
Autoimmune uveitis 9A96 Peripheral monocyte 7.60E-02 -1.28E-01 -1.72E+00
Autosomal dominant monocytopenia 4B04 Whole blood 6.29E-02 1.47E-01 7.00E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.50E-02 1.00E-01 3.51E-01
Batten disease 5C56.1 Whole blood 7.89E-01 4.39E-03 4.73E-02
Behcet's disease 4A62 Peripheral blood 2.82E-01 1.71E-02 1.28E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.75E-01 -5.67E-02 -4.40E-01
Bladder cancer 2C94 Bladder tissue 4.10E-05 -3.48E+00 -3.65E+00
Breast cancer 2C60-2C6Z Breast tissue 4.54E-19 -1.35E+00 -1.11E+00
Cardioembolic stroke 8B11.20 Whole blood 4.54E-01 3.42E-02 2.46E-01
Cervical cancer 2C77 Cervical tissue 1.18E-01 6.24E-01 5.68E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.35E-01 -2.83E-02 -1.59E-01
Chronic hepatitis C 1E51.1 Whole blood 2.24E-01 4.06E-02 2.38E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 8.26E-01 1.47E-02 3.39E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.83E-02 -2.15E-01 -2.50E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.34E-01 1.94E-01 2.60E-01
Colon cancer 2B90 Colon tissue 2.65E-173 -4.12E+00 -5.57E+00
Coronary artery disease BA80-BA8Z Peripheral blood 6.13E-01 -1.00E-01 -4.09E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.77E-01 -5.22E-03 -3.25E-02
Endometriosis GA10 Endometrium tissue 1.12E-02 -4.03E+00 -1.74E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.82E-01 2.38E-02 1.55E-01
Familial hypercholesterolemia 5C80.00 Whole blood 7.65E-01 -4.12E-03 -2.87E-02
Gastric cancer 2B72 Gastric tissue 4.55E-01 8.52E-01 3.77E-01
Glioblastopma 2A00.00 Nervous tissue 1.40E-02 -7.96E-02 -2.79E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.25E-01 9.04E-02 5.84E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.15E-04 -5.38E-01 -1.67E+00
Head and neck cancer 2D42 Head and neck tissue 3.41E-10 7.41E-01 8.92E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.13E-01 -6.50E-02 -1.80E-01
Huntington's disease 8A01.10 Whole blood 5.38E-01 1.82E-02 1.31E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.36E-01 -4.09E-02 -8.12E-02
Immunodeficiency 4A00-4A20 Peripheral blood 8.74E-01 5.74E-02 4.34E-01
Influenza 1E30 Whole blood 1.41E-01 4.23E-01 1.67E+00
Interstitial cystitis GC00.3 Bladder tissue 5.89E-01 -5.43E-02 -1.28E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.39E-03 2.55E-01 1.49E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.08E-01 -5.08E-01 -7.96E-01
Ischemic stroke 8B11 Peripheral blood 8.57E-03 1.48E-01 8.57E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.27E-01 -5.97E-02 -2.41E-01
Lateral sclerosis 8B60.4 Skin 6.85E-01 -1.07E-01 -2.96E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 2.73E-02 1.26E-01 1.08E+00
Liver cancer 2C12.0 Liver tissue 4.88E-27 -1.16E+00 -2.19E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.26E-04 -2.11E+00 -4.34E+00
Lung cancer 2C25 Lung tissue 6.88E-01 -4.96E-01 -8.16E-01
Lupus erythematosus 4A40 Whole blood 8.63E-01 -5.08E-02 -1.81E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.90E-01 -8.34E-04 -6.49E-03
Major depressive disorder 6A70-6A7Z Whole blood 7.93E-01 8.41E-03 3.96E-02
Melanoma 2C30 Skin 7.04E-04 -2.81E+00 -1.24E+00
Multiple myeloma 2A83.1 Peripheral blood 5.45E-01 2.98E-02 2.20E-01
Multiple myeloma 2A83.1 Bone marrow 3.03E-02 -1.54E-01 -8.19E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.57E-01 -3.67E-03 -2.48E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.52E-02 4.39E-02 2.70E-01
Myelofibrosis 2A20.2 Whole blood 8.36E-02 -9.42E-02 -7.71E-01
Myocardial infarction BA41-BA50 Peripheral blood 9.18E-01 -9.28E-03 -2.16E-02
Myopathy 8C70.6 Muscle tissue 8.73E-01 -5.65E-02 -2.81E-01
Neonatal sepsis KA60 Whole blood 9.27E-01 5.03E-03 2.57E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.81E-01 -3.05E-01 -9.32E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 2.20E-01 -2.47E-01 -3.79E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.36E-02 -2.62E-01 -4.31E-01
Olive pollen allergy CA08.00 Peripheral blood 5.84E-01 6.39E-02 3.88E-01
Oral cancer 2B6E Oral tissue 5.06E-04 8.68E-01 9.23E-01
Osteoarthritis FA00-FA0Z Synovial tissue 9.31E-01 1.14E-01 5.05E-01
Osteoporosis FB83.1 Bone marrow 4.86E-02 1.49E-01 1.28E+00
Ovarian cancer 2C73 Ovarian tissue 6.23E-01 8.97E-02 7.82E-02
Pancreatic cancer 2C10 Pancreas 9.35E-03 5.81E-01 3.44E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.71E-01 -5.63E-04 -2.81E-03
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 7.10E-01 3.83E-03 2.34E-02
Pituitary cancer 2D12 Pituitary tissue 3.22E-01 -1.54E-01 -3.31E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.55E-01 -1.29E-01 -2.65E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.12E-01 6.30E-02 3.79E-01
Polycythemia vera 2A20.4 Whole blood 5.94E-01 -1.47E-03 -9.30E-03
Pompe disease 5C51.3 Biceps muscle 1.32E-01 5.84E-02 5.68E-01
Preterm birth KA21.4Z Myometrium 8.91E-01 -1.08E-02 -7.14E-03
Prostate cancer 2C82 Prostate 4.21E-02 -3.86E-01 -3.06E-01
Psoriasis EA90 Skin 1.05E-10 1.47E+00 1.30E+00
Rectal cancer 2B92 Rectal colon tissue 8.17E-10 -3.03E+00 -7.52E+00
Renal cancer 2C90-2C91 Kidney 2.09E-02 -9.27E-01 -1.01E+00
Retinoblastoma 2D02.2 Uvea 9.76E-05 -2.89E+00 -1.99E+00
Rheumatoid arthritis FA20 Synovial tissue 8.01E-01 -5.63E-02 -2.12E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.25E-01 1.54E-01 3.86E-01
Schizophrenia 6A20 Prefrontal cortex 3.52E-01 -5.49E-02 -2.11E-01
Schizophrenia 6A20 Superior temporal cortex 4.11E-01 4.23E-02 3.04E-01
Scleroderma 4A42.Z Whole blood 8.50E-01 9.08E-03 8.70E-02
Seizure 8A60-8A6Z Whole blood 6.55E-01 1.90E-02 9.66E-02
Sensitive skin EK0Z Skin 6.49E-01 2.98E-01 4.85E-01
Sepsis with septic shock 1G41 Whole blood 7.72E-05 4.43E-02 1.77E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.49E-01 3.13E-02 1.47E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.40E-01 -2.28E-02 -1.53E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.20E-01 -1.49E-01 -1.17E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.56E-01 -2.67E-01 -9.98E-01
Skin cancer 2C30-2C3Z Skin 1.49E-29 -1.67E+00 -1.23E+00
Thrombocythemia 3B63 Whole blood 8.14E-03 9.87E-02 6.53E-01
Thrombocytopenia 3B64 Whole blood 1.14E-01 -2.29E-01 -1.07E+00
Thyroid cancer 2D10 Thyroid 2.56E-06 4.39E-02 1.96E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.04E-04 -2.41E-01 -1.69E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.48E-01 -3.87E-02 -2.00E-01
Type 2 diabetes 5A11 Liver tissue 4.20E-01 6.98E-03 1.60E-02
Ureter cancer 2C92 Urothelium 3.07E-01 -3.43E-02 -1.67E-01
Uterine cancer 2C78 Endometrium tissue 1.04E-09 -1.15E+00 -4.83E-01
Vitiligo ED63.0 Skin 9.81E-01 -6.35E-01 -6.92E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Estradiol 17-beta-dehydrogenase 2 DTT Info

References

1 Steroid signalling in the ovarian surface epithelium. Trends Endocrinol Metab. 2005 Sep;16(7):327-33.