General Information of Drug-Metabolizing Enzyme (DME) (ID: DEBMX7C)

DME Name Dimethylaniline oxidase 5 (FMO5)
Synonyms Dimethylaniline monooxygenase [N-oxide-forming] 5; FMO 5; FMO5; Hepatic flavin-containing monooxygenase 5
Gene Name FMO5
UniProt ID
FMO5_HUMAN
INTEDE ID
DME0634
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
2330
EC Number EC: 1.14.13.8
Oxidoreductase
Oxygen paired donor oxidoreductase
NADH/NADPH donor oxidoreductase
EC: 1.14.13.8
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MTKKRIAVIGGGVSGLSSIKCCVEEGLEPVCFERTDDIGGLWRFQENPEEGRASIYKSVI
INTSKEMMCFSDYPIPDHYPNFMHNAQVLEYFRMYAKEFDLLKYIRFKTTVCSVKKQPDF
ATSGQWEVVTESEGKKEMNVFDGVMVCTGHHTNAHLPLESFPGIEKFKGQYFHSRDYKNP
EGFTGKRVIIIGIGNSGGDLAVEISQTAKQVFLSTRRGAWILNRVGDYGYPADVLFSSRL
THFIWKICGQSLANKYLEKKINQRFDHEMFGLKPKHRALSQHPTLNDDLPNRIISGLVKV
KGNVKEFTETAAIFEDGSREDDIDAVIFATGYSFDFPFLEDSVKVVKNKISLYKKVFPPN
LERPTLAIIGLIQPLGAIMPISELQGRWATQVFKGLKTLPSQSEMMAEISKAQEEIDKRY
VESQRHTIQGDYIDTMEELADLVGVRPNLLSLAFTDPKLALHLLLGPCTPIHYRVQGPGK
WDGARKAILTTDDRIRKPLMTRVVERSSSMTSTMTIGKFMLALAFFAIIIAYF
Function
This enzyme is expressed in fetal and adult liver. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics.
KEGG Pathway
Drug metabolism - cytochrome P450 (hsa00982 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Ranitidine DM0GUSX Gastric ulcer DA60 Approved [1]
1 Discontinued Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Nomifensine DMCP2TS Breast cancer 2C60-2C65 Withdrawn from market [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.02E-04 1.05E-02 6.90E-02
Alzheimer's disease 8A20 Entorhinal cortex 6.17E-04 1.66E-01 5.17E-01
Asthma CA23 Nasal and bronchial airway 6.58E-04 -3.56E-01 -2.61E-01
Behcet's disease 4A62 Peripheral blood 7.61E-01 -1.46E-02 -4.40E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.50E-01 4.79E-03 3.86E-02
Bladder cancer 2C94 Bladder tissue 3.00E-03 -9.73E-01 -2.35E+00
Breast cancer 2C60-2C6Z Breast tissue 5.70E-04 -3.09E-01 -3.25E-01
Colon cancer 2B90 Colon tissue 1.88E-57 -1.96E+00 -2.17E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.56E-01 1.34E-01 8.80E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.35E-01 -1.27E-01 -7.55E-01
Gastric cancer 2B72 Gastric tissue 3.28E-01 -1.46E+00 -8.73E-01
Glioblastopma 2A00.00 Nervous tissue 5.39E-02 -4.98E-02 -1.47E-01
Head and neck cancer 2D42 Head and neck tissue 3.29E-13 -4.23E-01 -3.03E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.10E-01 -1.13E-02 -4.86E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.31E-03 -2.49E+00 -2.84E+00
Interstitial cystitis GC00.3 Bladder tissue 1.96E-03 -7.53E-01 -2.23E+00
Ischemic stroke 8B11 Peripheral blood 3.68E-01 -4.26E-02 -9.37E-02
Liver cancer 2C12.0 Liver tissue 6.70E-05 -3.68E-01 -4.91E-01
Liver failure DB99.7-DB99.8 Liver tissue 3.67E-03 -2.68E+00 -8.50E+00
Lung cancer 2C25 Lung tissue 7.69E-06 -7.75E-01 -7.95E-01
Lupus erythematosus 4A40 Whole blood 1.40E-02 1.58E-01 2.54E-01
Major depressive disorder 6A70-6A7Z Hippocampus 1.48E-01 -5.42E-02 -4.28E-01
Multiple myeloma 2A83.1 Bone marrow 1.03E-01 -6.22E-02 -8.20E-01
Multiple myeloma 2A83.1 Peripheral blood 3.62E-01 1.67E-02 1.07E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.65E-01 -2.39E-01 -4.89E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.35E-03 1.40E-01 5.47E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.88E-01 2.01E-02 2.98E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.70E-05 -7.40E-01 -2.38E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.17E-01 1.38E-01 8.90E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.73E-01 4.29E-02 4.77E-01
Olive pollen allergy CA08.00 Peripheral blood 5.93E-01 -1.14E-02 -6.71E-02
Oral cancer 2B6E Oral tissue 2.62E-01 -9.10E-02 -2.37E-01
Ovarian cancer 2C73 Ovarian tissue 2.52E-02 -5.33E-01 -1.89E+00
Pancreatic cancer 2C10 Pancreas 5.80E-01 -1.95E-01 -1.49E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 3.48E-01 1.31E-01 4.21E-01
Pituitary cancer 2D12 Pituitary tissue 4.64E-02 -2.64E-01 -4.65E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.54E-01 -4.37E-02 -4.52E-01
Pompe disease 5C51.3 Biceps muscle 1.19E-01 -5.23E-02 -3.06E-01
Prostate cancer 2C82 Prostate 9.33E-06 8.14E-01 1.21E+00
Psoriasis EA90 Skin 3.39E-10 -6.95E-01 -1.12E+00
Rectal cancer 2B92 Rectal colon tissue 3.77E-03 -1.57E+00 -1.97E+00
Renal cancer 2C90-2C91 Kidney 2.82E-03 -1.08E+00 -1.46E+00
Retinoblastoma 2D02.2 Uvea 9.41E-01 -3.99E-02 -9.02E-01
Schizophrenia 6A20 Prefrontal cortex 6.82E-03 1.23E-01 5.05E-01
Schizophrenia 6A20 Superior temporal cortex 5.48E-01 -1.43E-02 -1.39E-01
Scleroderma 4A42.Z Whole blood 1.77E-02 1.50E-01 1.10E+00
Seizure 8A60-8A6Z Whole blood 3.36E-01 -8.63E-02 -2.62E-01
Sepsis with septic shock 1G41 Whole blood 4.60E-03 -1.97E-02 -5.80E-02
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.11E-02 1.29E-01 1.05E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 8.14E-01 0.00E+00 0.00E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.86E-01 -1.64E-01 -3.07E-01
Skin cancer 2C30-2C3Z Skin 3.50E-59 -1.35E+00 -1.71E+00
Thrombocythemia 3B63 Whole blood 3.61E-03 2.90E-02 1.15E-01
Thrombocytopenia 3B64 Whole blood 7.18E-01 -2.32E-03 -5.77E-03
Thyroid cancer 2D10 Thyroid 5.27E-18 2.50E-01 1.22E+00
Tibial muscular dystrophy 8C75 Muscle tissue 9.51E-01 1.78E-02 1.22E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.26E-02 1.36E-01 1.85E+00
Type 2 diabetes 5A11 Liver tissue 7.79E-01 3.24E-02 7.01E-02
Ureter cancer 2C92 Urothelium 8.18E-01 5.28E-02 2.06E-01
Uterine cancer 2C78 Endometrium tissue 1.83E-02 -1.23E-01 -3.36E-01
Vitiligo ED63.0 Skin 7.21E-01 -1.76E-03 -2.74E-03
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 61 Diseases

References

1 Drug metabolism by flavin-containing monooxygenases of human and mouse. Expert Opin Drug Metab Toxicol. 2017 Feb;13(2):167-181.