General Information of Drug-Metabolizing Enzyme (DME) (ID: DEBQ2WU)

DME Name Uridine phosphorylase 2 (UPP2)
Synonyms Pyrimidine nucleoside phosphorylase 2; Uridinephosphorylase 2; UrdPase 2; UPase 2; UPP2
Gene Name UPP2
UniProt ID
UPP2_HUMAN
INTEDE ID
DME0140
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
151531
EC Number EC: 2.4.2.3
Transferase
Glycosyltransferases
Pentosyltransferase
EC: 2.4.2.3
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MASVIPASNRSMRSDRNTYVGKRFVHVKNPYLDLMDEDILYHLDLGTKTHNLPAMFGDVK
FVCVGGSPNRMKAFALFMHKELGFEEAEEDIKDICAGTDRYCMYKTGPVLAISHGMGIPS
ISIMLHELIKLLHHARCCDVTIIRIGTSGGIGIAPGTVVITDIAVDSFFKPRFEQVILDN
IVTRSTELDKELSEELFNCSKEIPNFPTLVGHTMCTYDFYEGQGRLDGALCSFSREKKLD
YLKRAFKAGVRNIEMESTVFAAMCGLCGLKAAVVCVTLLDRLDCDQINLPHDVLVEYQQR
PQLLISNFIRRRLGLCD
Function
This enzyme catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. It shows substrate specificity and accepts uridine, deoxyuridine, and thymidine as well as the two pyrimidine nucleoside analogs 5-fluorouridine and 5-fluoro-2(')-deoxyuridine as substrates.
KEGG Pathway
Drug metabolism - other enzymes (hsa00983 )
Metabolic pathways (hsa01100 )
Pyrimidine metabolism (hsa00240 )
Reactome Pathway
Pyrimidine salvage (R-HSA-73614 )
Pyrimidine catabolism (R-HSA-73621 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Fluorouracil DMUM7HZ Adenocarcinoma 2D40 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.29E-05 5.40E-02 4.32E-01
Alopecia ED70 Skin from scalp 1.91E-01 -1.36E-02 -6.50E-02
Alzheimer's disease 8A20 Entorhinal cortex 1.08E-02 -5.47E-02 -2.17E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.55E-01 1.07E-02 1.38E-01
Aortic stenosis BB70 Calcified aortic valve 7.68E-01 -6.82E-02 -1.24E-01
Apnea 7A40 Hyperplastic tonsil 8.82E-01 -6.14E-02 -4.12E-01
Arthropathy FA00-FA5Z Peripheral blood 1.53E-01 5.88E-02 4.57E-01
Asthma CA23 Nasal and bronchial airway 5.91E-05 -7.46E-02 -1.17E-01
Atopic dermatitis EA80 Skin 1.38E-01 3.18E-02 4.45E-01
Autism 6A02 Whole blood 4.66E-01 -1.35E-02 -7.33E-02
Autoimmune uveitis 9A96 Peripheral monocyte 2.36E-03 -1.36E-01 -9.51E-01
Autosomal dominant monocytopenia 4B04 Whole blood 6.16E-01 -5.20E-02 -3.64E-01
Bacterial infection of gingival 1C1H Gingival tissue 4.59E-01 -5.33E-03 -3.23E-02
Batten disease 5C56.1 Whole blood 1.10E-01 4.47E-02 8.77E-01
Behcet's disease 4A62 Peripheral blood 4.36E-01 5.34E-02 2.70E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.77E-01 6.80E-02 2.94E-01
Bladder cancer 2C94 Bladder tissue 1.66E-03 3.98E-01 2.04E+00
Breast cancer 2C60-2C6Z Breast tissue 3.86E-05 -4.57E-02 -2.52E-01
Cardioembolic stroke 8B11.20 Whole blood 1.50E-04 1.29E-01 8.92E-01
Cervical cancer 2C77 Cervical tissue 6.31E-01 -3.96E-02 -1.41E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.50E-01 -5.62E-03 -4.04E-02
Chronic hepatitis C 1E51.1 Whole blood 8.60E-01 1.70E-04 1.43E-03
Chronic obstructive pulmonary disease CA22 Lung tissue 2.95E-01 2.47E-02 2.27E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.77E-02 3.93E-02 3.44E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.08E-01 4.97E-02 5.18E-01
Colon cancer 2B90 Colon tissue 1.66E-01 1.52E-02 9.50E-02
Coronary artery disease BA80-BA8Z Peripheral blood 5.47E-01 -8.10E-02 -4.34E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.05E-01 -2.43E-02 -1.43E-01
Endometriosis GA10 Endometrium tissue 6.64E-02 1.00E-01 6.22E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.63E-01 -9.39E-03 -8.10E-02
Familial hypercholesterolemia 5C80.00 Whole blood 4.80E-01 -6.46E-03 -4.57E-02
Gastric cancer 2B72 Gastric tissue 8.29E-01 -8.27E-02 -8.47E-01
Glioblastopma 2A00.00 Nervous tissue 1.23E-61 -3.52E-01 -1.12E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.23E-01 1.54E-01 1.74E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.00E-02 -2.70E-01 -9.53E-01
Head and neck cancer 2D42 Head and neck tissue 2.10E-01 -2.00E-02 -1.78E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.67E-02 -1.52E-01 -6.04E-01
Huntington's disease 8A01.10 Whole blood 1.22E-01 -4.08E-02 -4.15E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.74E-01 -7.01E-02 -4.44E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.32E-01 5.09E-02 6.30E-01
Influenza 1E30 Whole blood 3.87E-02 1.85E-01 2.07E+00
Interstitial cystitis GC00.3 Bladder tissue 9.27E-01 2.68E-03 3.16E-02
Intracranial aneurysm 8B01.0 Intracranial artery 3.83E-01 4.50E-02 2.87E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.49E-01 9.01E-02 2.81E-01
Ischemic stroke 8B11 Peripheral blood 4.80E-01 2.70E-02 2.19E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.90E-01 6.91E-02 2.34E-01
Lateral sclerosis 8B60.4 Skin 6.92E-01 -1.04E-01 -8.13E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 9.85E-01 1.39E-01 5.28E-01
Liver cancer 2C12.0 Liver tissue 4.28E-04 -1.33E+00 -7.33E-01
Liver failure DB99.7-DB99.8 Liver tissue 8.12E-01 7.72E-02 2.43E-01
Lung cancer 2C25 Lung tissue 1.86E-02 1.24E-02 9.95E-02
Lupus erythematosus 4A40 Whole blood 4.09E-01 -4.74E-02 -2.04E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.84E-01 6.38E-02 2.87E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.77E-01 8.65E-03 4.82E-02
Melanoma 2C30 Skin 5.45E-01 -3.00E-02 -8.64E-02
Multiple myeloma 2A83.1 Peripheral blood 2.75E-01 4.04E-02 4.29E-01
Multiple myeloma 2A83.1 Bone marrow 5.69E-05 -2.77E-01 -2.91E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.04E-01 -1.26E-01 -2.87E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.42E-03 5.12E-02 5.16E-01
Myelofibrosis 2A20.2 Whole blood 3.10E-01 5.93E-02 5.74E-01
Myocardial infarction BA41-BA50 Peripheral blood 9.34E-02 7.82E-02 2.70E-01
Myopathy 8C70.6 Muscle tissue 3.50E-02 -8.46E-02 -7.07E-01
Neonatal sepsis KA60 Whole blood 1.61E-03 7.89E-02 4.87E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.87E-02 -9.21E-02 -5.73E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 2.88E-01 2.06E+00 8.91E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.06E-01 7.01E-02 9.59E-01
Olive pollen allergy CA08.00 Peripheral blood 7.71E-02 1.38E-01 1.97E+00
Oral cancer 2B6E Oral tissue 7.05E-02 -6.53E-02 -3.21E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.43E-01 -1.25E-01 -6.65E-01
Osteoporosis FB83.1 Bone marrow 4.43E-01 7.64E-02 9.43E-01
Ovarian cancer 2C73 Ovarian tissue 6.49E-01 -2.39E-02 -1.25E-01
Pancreatic cancer 2C10 Pancreas 2.29E-02 -1.82E-01 -5.81E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.46E-01 2.70E-02 1.51E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.23E-01 1.68E-02 1.70E-01
Pituitary cancer 2D12 Pituitary tissue 4.02E-01 1.07E-01 4.25E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.03E-01 1.41E-01 5.01E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.51E-01 4.03E-02 5.18E-01
Polycythemia vera 2A20.4 Whole blood 4.98E-05 1.27E-01 1.17E+00
Pompe disease 5C51.3 Biceps muscle 1.45E-02 -1.42E-01 -8.98E-01
Preterm birth KA21.4Z Myometrium 2.42E-01 -9.74E-02 -6.03E-01
Prostate cancer 2C82 Prostate 6.82E-02 -1.56E-01 -5.85E-01
Psoriasis EA90 Skin 2.00E-02 -2.07E-02 -1.16E-01
Rectal cancer 2B92 Rectal colon tissue 7.27E-01 2.80E-02 2.91E-01
Renal cancer 2C90-2C91 Kidney 3.42E-04 -2.50E+00 -1.99E+00
Retinoblastoma 2D02.2 Uvea 6.95E-04 -1.81E-01 -2.99E+00
Rheumatoid arthritis FA20 Synovial tissue 9.26E-02 -2.19E-01 -1.12E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.89E-01 -1.34E-02 -1.36E-01
Schizophrenia 6A20 Prefrontal cortex 3.29E-01 4.88E-03 1.54E-02
Schizophrenia 6A20 Superior temporal cortex 3.63E-01 1.28E-02 1.46E-01
Scleroderma 4A42.Z Whole blood 9.73E-01 2.56E-03 3.41E-02
Seizure 8A60-8A6Z Whole blood 5.94E-01 -1.03E-01 -5.45E-01
Sensitive skin EK0Z Skin 4.37E-02 -9.87E-02 -8.26E-01
Sepsis with septic shock 1G41 Whole blood 3.78E-03 5.78E-02 3.24E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.69E-01 2.70E-01 1.28E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.69E-01 2.55E-02 1.78E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 2.13E-01 6.43E-02 7.10E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.30E-01 -1.52E-02 -9.69E-02
Skin cancer 2C30-2C3Z Skin 9.78E-02 2.30E-02 1.15E-01
Thrombocythemia 3B63 Whole blood 2.49E-02 5.93E-02 5.71E-01
Thrombocytopenia 3B64 Whole blood 8.72E-01 1.62E-03 1.28E-02
Thyroid cancer 2D10 Thyroid 5.45E-06 7.68E-02 5.57E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.39E-01 -1.04E-01 -8.31E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.32E-01 2.13E-01 9.29E-01
Type 2 diabetes 5A11 Liver tissue 1.87E-01 1.14E-01 5.23E-01
Ureter cancer 2C92 Urothelium 6.33E-01 -2.60E-02 -1.88E-01
Uterine cancer 2C78 Endometrium tissue 2.59E-01 4.41E-02 2.30E-01
Vitiligo ED63.0 Skin 4.00E-01 -9.13E-02 -6.70E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Uridine phosphorylase in breast cancer: a new prognostic factor? Front Biosci. 2006 Sep 1;11:2759-66.