Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DECH1VP)

DME Name Bleomycin hydrolase (BLMH)
Synonyms BLM hydrolase; Reactive electrophile homocysteine thiolactone hydrolase; BH; BLMH; BMH
Gene Name BLMH
UniProt ID
BLMH_HUMAN
INTEDE ID
DME0086
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
642
EC Number EC: 3.4.22.40
Hydrolases
Peptidase
Cysteine protease
EC: 3.4.22.40
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSSSGLNSEKVAALIQKLNSDPQFVLAQNVGTTHDLLDICLKRATVQRAQHVFQHAVPQE
GKPITNQKSSGRCWIFSCLNVMRLPFMKKLNIEEFEFSQSYLFFWDKVERCYFFLSAFVD
TAQRKEPEDGRLVQFLLMNPANDGGQWDMLVNIVEKYGVIPKKCFPESYTTEATRRMNDI
LNHKMREFCIRLRNLVHSGATKGEISATQDVMMEEIFRVVCICLGNPPETFTWEYRDKDK
NYQKIGPITPLEFYREHVKPLFNMEDKICLVNDPRPQHKYNKLYTVEYLSNMVGGRKTLY
NNQPIDFLKKMVAASIKDGEAVWFGCDVGKHFNSKLGLSDMNLYDHELVFGVSLKNMNKA
ERLTFGESLMTHAMTFTAVSEKDDQDGAFTKWRVENSWGEDHGHKGYLCMTDEWFSEYVY
EVVVDRKHVPEEVLAVLEQEPIILPAWDPMGALAE
Function
This enzyme catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B-aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity.
Reactome Pathway
Antigen processing-Ubiquitination & Proteasome degradation (R-HSA-983168 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Bleomycin DMNER5S Cervical cancer 2C77.0 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.23E-27 7.27E-01 1.63E+00
Alopecia ED70 Skin from scalp 1.53E-05 -3.53E-01 -9.01E-01
Alzheimer's disease 8A20 Entorhinal cortex 7.79E-05 -9.87E-02 -4.00E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.40E-03 2.73E-01 1.53E+00
Aortic stenosis BB70 Calcified aortic valve 8.51E-01 1.25E-01 1.18E-01
Apnea 7A40 Hyperplastic tonsil 6.61E-01 -6.89E-02 -1.22E-01
Arthropathy FA00-FA5Z Peripheral blood 4.97E-01 -1.45E-01 -4.44E-01
Asthma CA23 Nasal and bronchial airway 1.90E-03 2.25E-01 3.10E-01
Atopic dermatitis EA80 Skin 1.11E-11 -1.78E+00 -4.17E+00
Autism 6A02 Whole blood 6.94E-01 3.58E-02 1.03E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.55E-01 -2.35E-01 -3.89E-01
Autosomal dominant monocytopenia 4B04 Whole blood 9.36E-01 -8.39E-02 -2.51E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.71E-05 -9.64E-02 -4.70E-01
Batten disease 5C56.1 Whole blood 3.78E-01 -3.70E-01 -1.40E+00
Behcet's disease 4A62 Peripheral blood 7.01E-01 5.84E-02 2.30E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.94E-01 -2.39E-02 -1.21E-01
Bladder cancer 2C94 Bladder tissue 5.12E-04 -3.39E-01 -2.09E+00
Breast cancer 2C60-2C6Z Breast tissue 5.56E-30 4.17E-01 9.18E-01
Cardioembolic stroke 8B11.20 Whole blood 9.23E-02 -9.48E-02 -4.99E-01
Cervical cancer 2C77 Cervical tissue 5.78E-03 -4.00E-01 -1.08E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.01E-01 7.92E-02 6.77E-02
Chronic hepatitis C 1E51.1 Whole blood 9.03E-02 -1.60E-01 -1.31E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 3.75E-01 6.71E-02 2.33E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.15E-05 -2.21E-01 -5.67E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.06E-02 -1.55E-01 -1.23E+00
Colon cancer 2B90 Colon tissue 1.88E-17 3.16E-01 1.08E+00
Coronary artery disease BA80-BA8Z Peripheral blood 2.08E-01 1.50E-01 3.74E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.42E-01 4.28E-01 4.97E-01
Endometriosis GA10 Endometrium tissue 1.10E-01 -2.17E-01 -5.77E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.51E-01 7.00E-02 2.59E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.06E-01 1.81E-01 6.24E-01
Gastric cancer 2B72 Gastric tissue 5.17E-02 3.45E-01 2.03E+00
Glioblastopma 2A00.00 Nervous tissue 2.38E-101 6.02E-01 1.55E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.86E-02 4.96E-01 4.46E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.01E-06 1.93E+00 2.84E+00
Head and neck cancer 2D42 Head and neck tissue 9.05E-05 1.77E-01 5.23E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.04E-01 6.45E-02 2.32E-01
Huntington's disease 8A01.10 Whole blood 7.55E-01 -4.51E-03 -1.49E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.01E-02 2.26E-01 1.64E+00
Immunodeficiency 4A00-4A20 Peripheral blood 4.16E-01 -1.99E-01 -7.55E-01
Influenza 1E30 Whole blood 7.25E-01 -1.26E-01 -3.24E-01
Interstitial cystitis GC00.3 Bladder tissue 1.87E-01 -6.08E-02 -5.20E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.04E-04 3.99E-01 3.08E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.16E-01 -4.10E-02 -1.76E-01
Ischemic stroke 8B11 Peripheral blood 9.35E-01 3.83E-03 1.68E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 8.24E-07 -8.79E-02 -2.80E-01
Lateral sclerosis 8B60.4 Skin 6.48E-01 4.69E-02 5.99E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.85E-01 -1.46E-01 -3.39E-01
Liver cancer 2C12.0 Liver tissue 2.28E-03 2.33E-01 6.10E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.25E-01 2.14E-01 8.55E-01
Lung cancer 2C25 Lung tissue 2.74E-16 1.52E-01 5.80E-01
Lupus erythematosus 4A40 Whole blood 9.93E-01 -5.82E-02 -8.24E-02
Major depressive disorder 6A70-6A7Z Hippocampus 2.50E-01 -6.76E-02 -3.56E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.78E-01 6.58E-03 2.83E-02
Melanoma 2C30 Skin 8.67E-01 -2.74E-01 -3.93E-01
Multiple myeloma 2A83.1 Peripheral blood 7.61E-01 -2.16E-01 -3.68E-01
Multiple myeloma 2A83.1 Bone marrow 4.58E-08 8.61E-01 6.35E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.79E-01 -1.63E-01 -4.03E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.74E-04 -2.11E-01 -7.20E-01
Myelofibrosis 2A20.2 Whole blood 2.48E-03 -5.66E-01 -3.52E+00
Myocardial infarction BA41-BA50 Peripheral blood 2.77E-01 -3.92E-01 -3.85E-01
Myopathy 8C70.6 Muscle tissue 1.61E-01 2.77E-01 8.00E-01
Neonatal sepsis KA60 Whole blood 1.34E-01 -9.71E-02 -1.97E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 8.05E-09 1.36E+00 4.81E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.81E-03 -3.98E-01 -1.52E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.22E-03 -5.23E-01 -1.71E+00
Olive pollen allergy CA08.00 Peripheral blood 1.87E-02 4.48E-01 1.97E+00
Oral cancer 2B6E Oral tissue 4.00E-05 4.76E-01 1.06E+00
Osteoarthritis FA00-FA0Z Synovial tissue 4.67E-01 2.29E-02 4.84E-02
Osteoporosis FB83.1 Bone marrow 3.94E-01 -1.39E-01 -1.14E+00
Ovarian cancer 2C73 Ovarian tissue 2.85E-01 2.15E-01 7.22E-01
Pancreatic cancer 2C10 Pancreas 2.51E-01 -6.67E-02 -1.16E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 7.82E-01 -8.58E-02 -3.07E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.26E-01 -1.32E-01 -6.40E-01
Pituitary cancer 2D12 Pituitary tissue 3.24E-03 4.60E-01 9.83E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.24E-02 4.66E-01 1.45E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.96E-01 -3.28E-02 -1.89E-01
Polycythemia vera 2A20.4 Whole blood 1.15E-17 -4.49E-01 -2.35E+00
Pompe disease 5C51.3 Biceps muscle 9.08E-03 5.36E-01 2.97E+00
Preterm birth KA21.4Z Myometrium 7.27E-01 -7.82E-02 -2.24E-01
Prostate cancer 2C82 Prostate 9.32E-01 -3.99E-02 -6.66E-02
Psoriasis EA90 Skin 1.72E-04 4.19E-01 7.13E-01
Rectal cancer 2B92 Rectal colon tissue 4.12E-02 1.56E-01 1.36E+00
Renal cancer 2C90-2C91 Kidney 1.35E-01 2.53E-01 4.68E-01
Retinoblastoma 2D02.2 Uvea 3.59E-03 4.06E-01 1.65E+00
Rheumatoid arthritis FA20 Synovial tissue 2.21E-02 5.64E-01 1.24E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.12E-01 8.30E-02 3.33E-01
Schizophrenia 6A20 Prefrontal cortex 6.53E-01 -3.16E-02 -6.30E-02
Schizophrenia 6A20 Superior temporal cortex 4.39E-01 -6.61E-02 -3.39E-01
Scleroderma 4A42.Z Whole blood 1.74E-05 -3.71E-01 -2.38E+00
Seizure 8A60-8A6Z Whole blood 5.22E-01 -1.16E-01 -2.43E-01
Sensitive skin EK0Z Skin 6.58E-02 4.34E-01 8.65E-01
Sepsis with septic shock 1G41 Whole blood 5.94E-28 -4.89E-01 -1.23E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.38E-03 -5.04E-01 -1.99E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.36E-03 -2.78E-01 -1.10E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 3.50E-01 4.21E-03 2.12E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.71E-01 2.22E-01 9.00E-01
Skin cancer 2C30-2C3Z Skin 3.14E-68 -1.42E+00 -2.00E+00
Thrombocythemia 3B63 Whole blood 9.63E-07 -4.41E-01 -2.97E+00
Thrombocytopenia 3B64 Whole blood 5.27E-01 -1.08E-02 -2.67E-02
Thyroid cancer 2D10 Thyroid 5.93E-01 -2.47E-02 -1.01E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.24E-02 1.24E-01 6.49E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.30E-02 -2.07E-01 -3.34E+00
Type 2 diabetes 5A11 Liver tissue 7.75E-01 2.31E-01 5.64E-01
Ureter cancer 2C92 Urothelium 8.78E-01 -8.77E-03 -3.69E-02
Uterine cancer 2C78 Endometrium tissue 2.04E-07 -3.77E-01 -7.47E-01
Vitiligo ED63.0 Skin 7.48E-01 9.10E-02 2.40E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 The C-terminus of human bleomycin hydrolase is required for protection against bleomycin-induced chromosomal damage. Mutat Res. 1998 Oct 12;421(1):1-7.