Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DECWT2V)

DME Name Folylpolyglutamate synthase (FPGS)
Synonyms Folylpoly-gamma-glutamate synthetase; Tetrahydrofolate synthase; Tetrahydrofolylpolyglutamate synthase; Mitochondrial Folylpolyglutamate synthase; FPGS
Gene Name FPGS
UniProt ID
FOLC_HUMAN
INTEDE ID
DME0191
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
2356
EC Number EC: 6.3.2.17
Ligase
Carbon-nitrogen ligase
Peptide synthase
EC: 6.3.2.17
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSRARSHLRAALFLAAASARGITTQVAARRGLSAWPVPQEPSMEYQDAVRMLNTLQTNAG
YLEQVKRQRGDPQTQLEAMELYLARSGLQVEDLDRLNIIHVTGTKGKGSTCAFTECILRS
YGLKTGFFSSPHLVQVRERIRINGQPISPELFTKYFWRLYHRLEETKDGSCVSMPPYFRF
LTLMAFHVFLQEKVDLAVVEVGIGGAYDCTNIIRKPVVCGVSSLGIDHTSLLGDTVEKIA
WQKGGIFKQGVPAFTVLQPEGPLAVLRDRAQQISCPLYLCPMLEALEEGGPPLTLGLEGE
HQRSNAALALQLAHCWLQRQDRHGAGEPKASRPGLLWQLPLAPVFQPTSHMRLGLRNTEW
PGRTQVLRRGPLTWYLDGAHTASSAQACVRWFRQALQGRERPSGGPEVRVLLFNATGDRD
PAALLKLLQPCQFDYAVFCPNLTEVSSTGNADQQNFTVTLDQVLLRCLEHQQHWNHLDEE
QASPDLWSAPSPEPGGSASLLLAPHPPHTCSASSLVFSCISHALQWISQGRDPIFQPPSP
PKGLLTHPVAHSGASILREAAAIHVLVTGSLHLVGGVLKLLEPALSQ
Function This enzyme catalyzes conversion of folates to polyglutamate derivatives and it can metabolizes methotrexate (MTX) to polyglutamates.
KEGG Pathway
Antifolate resistance (hsa01523 )
Folate biosynthesis (hsa00790 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Metabolism of folate and pterines (R-HSA-196757 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
2 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Methotrexate DM2TEOL Anterior urethra cancer Approved [1]
Pralatrexate DMAO80I Breast cancer 2C60-2C65 Approved [2]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
DACTHF DMCNAME N. A. N. A. Investigative [3]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.94E-49 5.45E-01 1.87E+00
Alopecia ED70 Skin from scalp 9.40E-01 3.77E-02 8.36E-02
Alzheimer's disease 8A20 Entorhinal cortex 8.14E-02 -6.33E-02 -4.23E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.63E-01 2.42E-01 1.60E+00
Aortic stenosis BB70 Calcified aortic valve 9.99E-01 5.04E-02 9.64E-02
Apnea 7A40 Hyperplastic tonsil 3.19E-01 -7.32E-02 -3.25E-01
Arthropathy FA00-FA5Z Peripheral blood 1.88E-02 -1.16E-01 -8.86E-01
Asthma CA23 Nasal and bronchial airway 1.68E-05 1.67E-01 1.69E-01
Atopic dermatitis EA80 Skin 9.23E-04 1.19E-01 6.27E-01
Autism 6A02 Whole blood 7.66E-04 -1.34E-01 -4.83E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.29E-02 -2.63E-01 -7.22E-01
Autosomal dominant monocytopenia 4B04 Whole blood 4.49E-01 -7.53E-02 -4.14E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.32E-05 1.52E-01 5.52E-01
Batten disease 5C56.1 Whole blood 2.48E-01 1.08E-01 6.66E-01
Behcet's disease 4A62 Peripheral blood 2.90E-01 -9.52E-02 -3.87E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.31E-01 -2.68E-02 -1.52E-01
Bladder cancer 2C94 Bladder tissue 5.45E-04 6.36E-01 2.40E+00
Breast cancer 2C60-2C6Z Breast tissue 2.34E-02 -9.92E-02 -2.92E-01
Cardioembolic stroke 8B11.20 Whole blood 2.85E-02 -1.66E-01 -5.37E-01
Cervical cancer 2C77 Cervical tissue 7.93E-02 2.00E-01 6.44E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.01E-01 1.19E-01 4.97E-01
Chronic hepatitis C 1E51.1 Whole blood 8.00E-01 2.46E-03 2.02E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 8.88E-01 -3.29E-02 -1.32E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.21E-01 2.51E-02 7.95E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.73E-02 1.68E-01 1.01E+00
Colon cancer 2B90 Colon tissue 9.94E-46 5.22E-01 1.63E+00
Coronary artery disease BA80-BA8Z Peripheral blood 8.45E-01 -4.07E-02 -8.62E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.65E-01 -5.70E-02 -1.10E-01
Endometriosis GA10 Endometrium tissue 1.38E-02 2.11E-01 6.82E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.62E-01 -3.82E-02 -3.36E-01
Familial hypercholesterolemia 5C80.00 Whole blood 4.96E-01 -1.72E-01 -7.64E-01
Gastric cancer 2B72 Gastric tissue 3.06E-01 3.44E-01 1.15E+00
Glioblastopma 2A00.00 Nervous tissue 9.60E-46 2.76E-01 7.76E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 9.58E-01 -1.74E-02 -2.37E-02
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.40E-01 3.20E-01 6.09E-01
Head and neck cancer 2D42 Head and neck tissue 1.68E-02 4.39E-02 1.50E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.13E-02 9.97E-02 4.03E-01
Huntington's disease 8A01.10 Whole blood 6.49E-01 6.84E-02 4.22E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.86E-01 -3.76E-02 -2.46E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.90E-01 2.65E-02 1.84E-01
Influenza 1E30 Whole blood 1.25E-02 -7.17E-01 -2.37E+00
Interstitial cystitis GC00.3 Bladder tissue 7.36E-01 1.84E-02 7.66E-02
Intracranial aneurysm 8B01.0 Intracranial artery 1.72E-01 1.29E-01 4.07E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.49E-01 2.83E-02 9.70E-02
Ischemic stroke 8B11 Peripheral blood 4.58E-01 -3.03E-02 -2.38E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 7.13E-01 6.70E-03 2.44E-02
Lateral sclerosis 8B60.4 Skin 2.65E-01 1.28E-01 8.88E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 8.38E-01 1.53E-02 3.14E-02
Liver cancer 2C12.0 Liver tissue 9.97E-08 -3.14E-01 -1.20E+00
Liver failure DB99.7-DB99.8 Liver tissue 2.66E-02 -3.28E-01 -8.67E-01
Lung cancer 2C25 Lung tissue 5.29E-01 2.73E-02 8.40E-02
Lupus erythematosus 4A40 Whole blood 4.81E-04 -4.20E-02 -1.12E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.80E-01 -8.40E-03 -5.07E-02
Major depressive disorder 6A70-6A7Z Whole blood 4.05E-01 -3.65E-02 -1.55E-01
Melanoma 2C30 Skin 1.21E-01 3.97E-01 6.05E-01
Multiple myeloma 2A83.1 Peripheral blood 1.56E-01 -1.66E-01 -9.22E-01
Multiple myeloma 2A83.1 Bone marrow 2.24E-05 4.27E-01 3.00E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.95E-01 -9.24E-02 -2.65E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.05E-03 -1.90E-01 -4.62E-01
Myelofibrosis 2A20.2 Whole blood 1.82E-01 7.53E-02 8.45E-01
Myocardial infarction BA41-BA50 Peripheral blood 2.71E-01 9.03E-04 2.00E-03
Myopathy 8C70.6 Muscle tissue 7.22E-01 -2.32E-02 -1.56E-01
Neonatal sepsis KA60 Whole blood 1.99E-14 -3.21E-01 -1.40E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 9.75E-02 -1.25E-01 -3.85E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 4.46E-01 -1.71E-01 -4.77E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.19E-01 -1.49E-01 -3.26E-01
Olive pollen allergy CA08.00 Peripheral blood 1.24E-01 1.63E-01 9.90E-01
Oral cancer 2B6E Oral tissue 1.75E-02 -1.32E-01 -4.01E-01
Osteoarthritis FA00-FA0Z Synovial tissue 5.28E-01 1.50E-01 2.40E-01
Osteoporosis FB83.1 Bone marrow 7.57E-01 5.00E-02 1.88E-01
Ovarian cancer 2C73 Ovarian tissue 1.53E-01 -1.76E-01 -3.26E-01
Pancreatic cancer 2C10 Pancreas 1.22E-01 -2.25E-01 -5.72E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.34E-02 -2.48E-01 -1.78E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.50E-01 -2.83E-02 -1.53E-01
Pituitary cancer 2D12 Pituitary tissue 1.59E-01 7.56E-02 2.53E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.94E-01 1.94E-01 6.74E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.24E-01 9.00E-02 4.66E-01
Polycythemia vera 2A20.4 Whole blood 4.17E-01 -2.88E-02 -2.78E-01
Pompe disease 5C51.3 Biceps muscle 1.78E-01 1.55E-01 6.29E-01
Preterm birth KA21.4Z Myometrium 2.45E-01 -3.44E-01 -1.12E+00
Prostate cancer 2C82 Prostate 1.80E-06 -1.01E+00 -1.52E+00
Psoriasis EA90 Skin 2.39E-04 -2.46E-01 -5.70E-01
Rectal cancer 2B92 Rectal colon tissue 9.36E-03 3.49E-01 1.22E+00
Renal cancer 2C90-2C91 Kidney 1.89E-02 -3.91E-01 -1.30E+00
Retinoblastoma 2D02.2 Uvea 7.94E-07 7.17E-01 3.06E+00
Rheumatoid arthritis FA20 Synovial tissue 2.21E-03 5.86E-01 1.65E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.45E-01 -2.22E-02 -1.73E-01
Schizophrenia 6A20 Prefrontal cortex 1.86E-01 3.12E-01 7.25E-01
Schizophrenia 6A20 Superior temporal cortex 5.22E-01 -4.38E-04 -4.78E-03
Scleroderma 4A42.Z Whole blood 1.47E-05 -2.20E-01 -1.91E+00
Seizure 8A60-8A6Z Whole blood 9.47E-01 -2.24E-02 -1.07E-01
Sensitive skin EK0Z Skin 9.73E-01 6.40E-03 5.44E-02
Sepsis with septic shock 1G41 Whole blood 6.54E-16 -2.09E-01 -9.29E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.25E-01 8.12E-02 3.13E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.42E-01 1.59E-01 7.50E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 8.64E-01 2.16E-02 5.65E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.27E-01 -2.87E-01 -1.29E+00
Skin cancer 2C30-2C3Z Skin 5.04E-03 2.90E-01 6.06E-01
Thrombocythemia 3B63 Whole blood 9.63E-01 2.23E-02 2.64E-01
Thrombocytopenia 3B64 Whole blood 2.76E-01 6.46E-01 1.09E+00
Thyroid cancer 2D10 Thyroid 6.51E-13 2.09E-01 1.14E+00
Tibial muscular dystrophy 8C75 Muscle tissue 4.08E-01 -7.68E-03 -1.55E-02
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.25E-02 3.45E-01 3.81E+00
Type 2 diabetes 5A11 Liver tissue 7.99E-02 -4.52E-01 -1.28E+00
Ureter cancer 2C92 Urothelium 1.14E-01 -4.61E-02 -2.06E-01
Uterine cancer 2C78 Endometrium tissue 5.69E-08 -3.16E-01 -5.71E-01
Vitiligo ED63.0 Skin 3.78E-01 1.68E-01 5.11E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 The pharmacogenetics of methotrexate. Rheumatology (Oxford). 2007 Oct;46(10):1520-4.
2 Pralatrexate : evaluation of clinical efficacy and toxicity in T-cell lymphoma. Expert Opin Pharmacother. 2013 Mar;14(4):515-23.
3 Role of folylpolyglutamate synthetase in the metabolism and cytotoxicity of 5-deazaacyclotetrahydrofolate, an anti-purine drug. J Biol Chem. 1994 Apr 1;269(13):9714-20.