Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEDH7FP)

DME Name Corticosteroid 11-beta-dehydrogenase 2 (HSD11B2)
Synonyms
NAD-dependent 11-beta-hydroxysteroid dehydrogenase; Short chain dehydrogenase/reductase family 9C member 3; Corticosteroid 11-beta-dehydrogenase isozyme 2; 11-beta-hydroxysteroid dehydrogenase type 2; 11-beta-hydroxysteroid dehydrogenase type II; 11-DH2; 11-HSD type II; 11-beta-HSD; 11-beta-HSD type II; 11-beta-HSD2; HSD11B2; HSD11K; SDR9C3
Gene Name HSD11B2
UniProt ID
DHI2_HUMAN
INTEDE ID
DME0419
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
3291
EC Number EC: 1.1.1.B40
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.B40
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAV
LAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPG
AIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELS
PVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVA
LLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYI
EHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRR
RFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR
Function This enzyme catalyzes the conversion of cortisol to the inactive metabolite cortisone.
KEGG Pathway
Aldosterone-regulated sodium reabsorption (hsa04960 )
Metabolic pathways (hsa01100 )
Steroid hormone biosynthesis (hsa00140 )
Reactome Pathway
Glucocorticoid biosynthesis (R-HSA-194002 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
4 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Beclomethasone DMZPHIK Allergic rhinitis CA08.0 Approved [4]
Betamethasone Valerate DMMIAXO Dermatological disease DA24.Y Approved [4]
Cortisone Acetate DMG8K57 Acne vulgaris ED80 Approved [5]
Dexamethasone DMMWZET Acute adrenal insufficiency Approved [4]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Dehydrocorticosterone DM48KMB N. A. N. A. Investigative [5]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
Cortisone Acetate Acne vulgaris [ED80] Approved Km = 0.00052 microM [5]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.56E-01 4.09E-03 1.80E-02
Alopecia ED70 Skin from scalp 2.74E-02 1.57E-01 4.21E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.14E-04 2.85E-01 7.34E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.81E-02 1.79E-01 1.25E+00
Aortic stenosis BB70 Calcified aortic valve 5.24E-01 2.10E-02 1.04E-01
Apnea 7A40 Hyperplastic tonsil 3.52E-03 -9.35E-01 -1.73E+00
Arthropathy FA00-FA5Z Peripheral blood 7.05E-01 1.09E-01 6.21E-01
Asthma CA23 Nasal and bronchial airway 2.11E-07 1.71E+00 1.22E+00
Atopic dermatitis EA80 Skin 1.70E-05 6.09E-01 2.44E+00
Autism 6A02 Whole blood 9.31E-01 9.73E-03 4.09E-02
Autoimmune uveitis 9A96 Peripheral monocyte 2.32E-01 -1.36E-01 -6.19E-01
Autosomal dominant monocytopenia 4B04 Whole blood 7.75E-01 -7.95E-02 -4.62E-01
Bacterial infection of gingival 1C1H Gingival tissue 6.72E-10 -3.27E-01 -8.46E-01
Batten disease 5C56.1 Whole blood 7.83E-02 1.57E-01 1.17E+00
Behcet's disease 4A62 Peripheral blood 6.37E-01 5.05E-02 1.67E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.86E-02 -9.72E-02 -4.94E-01
Bladder cancer 2C94 Bladder tissue 8.23E-01 -1.81E-01 -3.80E-01
Breast cancer 2C60-2C6Z Breast tissue 3.84E-18 3.39E-01 5.75E-01
Cardioembolic stroke 8B11.20 Whole blood 5.85E-01 6.29E-02 2.24E-01
Cervical cancer 2C77 Cervical tissue 4.63E-02 -2.01E-01 -5.38E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.94E-01 2.30E-02 7.32E-02
Chronic hepatitis C 1E51.1 Whole blood 2.47E-01 1.13E-01 6.40E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.63E-02 -2.01E-01 -4.14E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.74E-01 4.94E-04 1.12E-03
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.64E-01 -2.32E-01 -1.12E+00
Colon cancer 2B90 Colon tissue 6.70E-187 -2.87E+00 -5.70E+00
Coronary artery disease BA80-BA8Z Peripheral blood 7.92E-01 -1.51E-02 -1.39E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.52E-01 2.24E-02 7.67E-02
Endometriosis GA10 Endometrium tissue 2.82E-02 -1.61E+00 -7.34E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.83E-01 1.10E-02 5.99E-02
Familial hypercholesterolemia 5C80.00 Whole blood 1.85E-01 -1.56E-02 -7.21E-02
Gastric cancer 2B72 Gastric tissue 4.67E-01 5.65E-01 5.44E-01
Glioblastopma 2A00.00 Nervous tissue 8.70E-17 9.23E-02 2.05E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.31E-01 -6.84E-01 -6.69E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.90E-05 -4.76E-01 -1.86E+00
Head and neck cancer 2D42 Head and neck tissue 4.37E-03 -2.38E-01 -5.06E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.12E-01 -1.75E-01 -3.88E-01
Huntington's disease 8A01.10 Whole blood 4.15E-01 1.54E-03 1.26E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.66E-02 4.57E-01 1.34E+00
Immunodeficiency 4A00-4A20 Peripheral blood 1.95E-01 3.61E-02 3.18E-01
Influenza 1E30 Whole blood 8.09E-03 3.42E-01 2.43E+00
Interstitial cystitis GC00.3 Bladder tissue 1.52E-02 -1.05E+00 -2.44E+00
Intracranial aneurysm 8B01.0 Intracranial artery 7.18E-03 -3.95E-01 -1.02E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.45E-02 -5.61E-01 -9.40E-01
Ischemic stroke 8B11 Peripheral blood 1.42E-01 1.24E-01 6.49E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.91E-01 8.55E-02 2.53E-01
Lateral sclerosis 8B60.4 Skin 7.53E-02 1.39E-01 2.18E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 8.29E-01 5.69E-02 1.90E-01
Liver cancer 2C12.0 Liver tissue 3.42E-05 5.59E-02 1.61E-01
Liver failure DB99.7-DB99.8 Liver tissue 4.79E-01 -1.31E-01 -4.33E-01
Lung cancer 2C25 Lung tissue 1.08E-02 -4.09E-02 -7.60E-02
Lupus erythematosus 4A40 Whole blood 7.23E-01 -1.82E-02 -5.87E-02
Major depressive disorder 6A70-6A7Z Hippocampus 1.29E-01 -8.43E-02 -4.13E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.19E-01 1.92E-02 6.94E-02
Melanoma 2C30 Skin 8.10E-04 -2.50E+00 -1.25E+00
Multiple myeloma 2A83.1 Peripheral blood 4.75E-01 1.37E-02 6.51E-02
Multiple myeloma 2A83.1 Bone marrow 4.05E-02 1.45E-01 8.96E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.15E-01 -2.26E-01 -6.33E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.92E-02 -8.58E-02 -4.40E-01
Myelofibrosis 2A20.2 Whole blood 1.44E-01 7.85E-02 6.22E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.34E-02 6.77E-02 2.29E-01
Myopathy 8C70.6 Muscle tissue 4.66E-03 2.06E-01 1.28E+00
Neonatal sepsis KA60 Whole blood 7.05E-01 -4.69E-03 -1.84E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.58E-05 3.46E-01 7.05E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 5.59E-01 3.18E-01 7.64E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.86E-01 -3.12E-02 -1.45E-01
Olive pollen allergy CA08.00 Peripheral blood 5.25E-01 -4.15E-03 -2.17E-02
Oral cancer 2B6E Oral tissue 2.98E-02 -3.17E-01 -2.27E-01
Osteoarthritis FA00-FA0Z Synovial tissue 6.99E-01 -1.12E-01 -3.09E-01
Osteoporosis FB83.1 Bone marrow 6.77E-01 1.20E-02 1.66E-01
Ovarian cancer 2C73 Ovarian tissue 7.65E-01 -1.96E-01 -2.33E-01
Pancreatic cancer 2C10 Pancreas 1.50E-02 4.54E-01 6.06E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 7.16E-01 -4.60E-02 -2.36E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.27E-01 4.66E-02 2.85E-01
Pituitary cancer 2D12 Pituitary tissue 6.10E-02 1.86E-01 5.57E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.45E-01 3.13E-01 1.03E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.81E-01 -3.89E-02 -2.27E-01
Polycythemia vera 2A20.4 Whole blood 5.04E-08 1.06E-01 9.54E-01
Pompe disease 5C51.3 Biceps muscle 9.80E-01 1.21E-01 2.53E-01
Preterm birth KA21.4Z Myometrium 2.31E-01 2.60E-01 1.02E+00
Prostate cancer 2C82 Prostate 9.43E-01 -3.44E-01 -3.82E-01
Psoriasis EA90 Skin 1.11E-05 -3.97E-01 -6.06E-01
Rectal cancer 2B92 Rectal colon tissue 3.06E-14 -2.00E+00 -8.67E+00
Renal cancer 2C90-2C91 Kidney 1.38E-05 -3.89E+00 -2.71E+00
Retinoblastoma 2D02.2 Uvea 4.83E-01 -7.28E-03 -5.23E-02
Rheumatoid arthritis FA20 Synovial tissue 1.07E-01 -2.23E-01 -4.62E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.07E-02 -5.03E-02 -9.71E-02
Schizophrenia 6A20 Prefrontal cortex 2.03E-01 5.03E-02 2.08E-01
Schizophrenia 6A20 Superior temporal cortex 9.54E-01 4.58E-02 2.60E-01
Scleroderma 4A42.Z Whole blood 8.99E-01 -9.07E-03 -7.14E-02
Seizure 8A60-8A6Z Whole blood 6.69E-02 4.66E-02 2.31E-01
Sensitive skin EK0Z Skin 3.06E-01 -3.61E-01 -5.29E-01
Sepsis with septic shock 1G41 Whole blood 8.23E-03 3.69E-02 1.24E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.92E-03 3.32E-01 1.24E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.12E-01 1.62E-01 1.09E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 4.10E-01 1.84E-01 5.35E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.05E-02 7.41E-01 1.74E+00
Skin cancer 2C30-2C3Z Skin 1.34E-99 -2.18E+00 -2.69E+00
Thrombocythemia 3B63 Whole blood 2.98E-02 8.05E-02 6.32E-01
Thrombocytopenia 3B64 Whole blood 2.48E-01 1.30E-02 6.45E-02
Thyroid cancer 2D10 Thyroid 5.86E-29 -1.46E+00 -1.93E+00
Tibial muscular dystrophy 8C75 Muscle tissue 6.58E-07 7.98E-01 2.48E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.18E-01 1.71E-01 7.11E-01
Type 2 diabetes 5A11 Liver tissue 1.65E-01 -1.77E-01 -1.16E+00
Ureter cancer 2C92 Urothelium 3.53E-01 -3.29E-02 -1.72E-01
Uterine cancer 2C78 Endometrium tissue 9.29E-23 -1.72E+00 -1.14E+00
Vitiligo ED63.0 Skin 9.07E-01 -4.38E-01 -5.01E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Corticosteroid 11-beta-dehydrogenase 2 (HSD11B2) DTT Info
DME DTT Type Clinical trial
1 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
RG-7234 DM5RAB9 Type-2 diabetes 5A11 Phase 2 [1]
4 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
11-keto-beta-boswellicacid DMM6CJI Discovery agent N.A. Investigative [2]
3-acetyl-11-keto-beta-boswellic acid DMGO2D7 Discovery agent N.A. Investigative [2]
Ganoderic acid A DM42EVG Discovery agent N.A. Investigative [2]
[(125)I] RB129 DMX0G7E Discovery agent N.A. Investigative [3]

References

1 New Therapeutic Strategies for Type 2 Diabetes: Small Molecule Approaches. 2012. Chapter 5. Page(131).
2 11beta-Hydroxysteroid dehydrogenase 1 inhibiting constituents from Eriobotrya japonica revealed by bioactivity-guided isolation and computational a... Bioorg Med Chem. 2010 Feb 15;18(4):1507-15.
3 Abnormal expression of 11 beta-hydroxysteroid dehydrogenase type 2 in human pituitary adenomas: a prereceptor determinant of pituitary cell proliferation. Oncogene. 2003 Mar 20;22(11):1663-7.
4 Metabolism of synthetic steroids by the human placenta. Placenta. 2007 Jan;28(1):39-46.
5 Comparative enzymology of 11beta-hydroxysteroid dehydrogenase type 1 from six species. J Mol Endocrinol. 2005 Aug;35(1):89-101.