Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEE1B8O)

DME Name Glucose-6-phosphatase beta (G6PC3)
Synonyms G6Pase-beta; Glucose-6-phosphatase 3; Ubiquitous glucose-6-phosphatase catalytic subunit-related protein; G-6-Pase 3; G6PC3; G6Pase 3; UGRP
Gene Name G6PC3
UniProt ID
G6PC3_HUMAN
INTEDE ID
DME0523
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
92579
EC Number EC: 3.1.3.9
Hydrolases
Ester bond hydrolase
Phosphoric monoester hydrolase
EC: 3.1.3.9
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MESTLGAGIVIAEALQNQLAWLENVWLWITFLGDPKILFLFYFPAAYYASRRVGIAVLWI
SLITEWLNLIFKWFLFGDRPFWWVHESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGA
ALWPIMTALSSQVATRARSRWVRVMPSLAYCTFLLAVGLSRIFILAHFPHQVLAGLITGA
VLGWLMTPRVPMERELSFYGLTALALMLGTSLIYWTLFTLGLDLSWSISLAFKWCERPEW
IHVDSRPFASLSRDSGAALGLGIALHSPCYAQVRRAQLGNGQKIACLVLAMGLLGPLDWL
GHPPQISLFYIFNFLKYTLWPCLVLALVPWAVHMFSAQEAPPIHSS
Function This enzyme hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum.
KEGG Pathway
AMPK signaling pathway (hsa04152 )
Adipocytokine signaling pathway (hsa04920 )
Carbohydrate digestion and absorption (hsa04973 )
FoxO signaling pathway (hsa04068 )
Galactose metabolism (hsa00052 )
Glucagon signaling pathway (hsa04922 )
Glycolysis / Gluconeogenesis (hsa00010 )
Insulin resistance (hsa04931 )
Insulin signaling pathway (hsa04910 )
Metabolic pathways (hsa01100 )
PI3K-Akt signaling pathway (hsa04151 )
Starch and sucrose metabolism (hsa00500 )
Reactome Pathway
Severe congenital neutropenia type 4 (G6PC3) (R-HSA-3282872 )
Gluconeogenesis (R-HSA-70263 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
D-glucose 6-phosphate DMNRW57 N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.41E-27 4.51E-01 1.58E+00
Alopecia ED70 Skin from scalp 2.45E-01 -6.82E-02 -1.81E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.35E-01 2.34E-02 1.13E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.61E-01 9.94E-02 4.52E-01
Aortic stenosis BB70 Calcified aortic valve 4.13E-01 1.69E-01 4.07E-01
Apnea 7A40 Hyperplastic tonsil 1.06E-02 -4.18E-01 -1.98E+00
Arthropathy FA00-FA5Z Peripheral blood 1.97E-01 -1.06E-01 -5.55E-01
Asthma CA23 Nasal and bronchial airway 2.79E-02 9.47E-02 1.60E-01
Atopic dermatitis EA80 Skin 5.46E-02 1.58E-01 8.49E-01
Autism 6A02 Whole blood 1.45E-02 -1.93E-01 -9.13E-01
Autoimmune uveitis 9A96 Peripheral monocyte 7.96E-01 -4.61E-02 -5.36E-01
Autosomal dominant monocytopenia 4B04 Whole blood 5.17E-01 3.69E-03 2.59E-02
Bacterial infection of gingival 1C1H Gingival tissue 8.84E-16 3.52E-01 1.29E+00
Batten disease 5C56.1 Whole blood 4.34E-01 4.54E-02 5.66E-01
Behcet's disease 4A62 Peripheral blood 4.63E-01 9.30E-02 4.48E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.32E-01 -5.11E-02 -2.38E-01
Bladder cancer 2C94 Bladder tissue 1.10E-01 1.96E-01 1.00E+00
Breast cancer 2C60-2C6Z Breast tissue 5.27E-20 2.29E-01 5.94E-01
Cardioembolic stroke 8B11.20 Whole blood 1.19E-02 -1.79E-01 -8.54E-01
Cervical cancer 2C77 Cervical tissue 3.00E-01 5.89E-02 3.25E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.69E-01 8.45E-02 2.32E-01
Chronic hepatitis C 1E51.1 Whole blood 7.52E-01 -4.78E-02 -3.87E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.13E-01 -1.25E-01 -4.34E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.20E-01 -7.01E-02 -2.08E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.83E-01 1.07E-01 5.93E-01
Colon cancer 2B90 Colon tissue 1.36E-20 2.93E-01 1.13E+00
Coronary artery disease BA80-BA8Z Peripheral blood 2.36E-01 3.69E-01 1.09E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.22E-01 -9.64E-02 -2.64E-01
Endometriosis GA10 Endometrium tissue 3.54E-03 -2.22E-01 -7.44E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.20E-01 -6.05E-03 -3.54E-02
Familial hypercholesterolemia 5C80.00 Whole blood 4.10E-05 7.42E-01 2.80E+00
Gastric cancer 2B72 Gastric tissue 2.30E-01 1.34E-03 7.47E-03
Glioblastopma 2A00.00 Nervous tissue 1.71E-39 3.49E-01 8.08E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.06E-01 1.82E-01 3.51E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.50E-02 3.39E-01 5.77E-01
Head and neck cancer 2D42 Head and neck tissue 2.94E-10 -2.52E-01 -4.43E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.88E-02 4.22E-02 2.08E-01
Huntington's disease 8A01.10 Whole blood 8.21E-01 2.77E-02 9.09E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.81E-01 1.40E-01 4.25E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.20E-02 1.35E-01 1.19E+00
Influenza 1E30 Whole blood 1.59E-01 -1.49E-01 -1.01E+00
Interstitial cystitis GC00.3 Bladder tissue 6.92E-01 3.43E-02 1.59E-01
Intracranial aneurysm 8B01.0 Intracranial artery 3.55E-03 5.17E-01 1.49E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.11E-01 -6.51E-02 -1.83E-01
Ischemic stroke 8B11 Peripheral blood 1.91E-01 -9.66E-02 -5.56E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.42E-02 -1.17E-01 -3.87E-01
Lateral sclerosis 8B60.4 Skin 3.03E-01 2.03E-01 6.71E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.82E-01 2.87E-01 5.73E-01
Liver cancer 2C12.0 Liver tissue 6.57E-08 1.50E-01 6.08E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.13E-06 8.41E-01 3.13E+00
Lung cancer 2C25 Lung tissue 4.59E-02 -4.90E-02 -1.58E-01
Lupus erythematosus 4A40 Whole blood 4.57E-02 1.75E-02 5.27E-02
Major depressive disorder 6A70-6A7Z Hippocampus 6.22E-01 -1.43E-03 -6.58E-03
Major depressive disorder 6A70-6A7Z Whole blood 4.97E-01 2.64E-02 9.44E-02
Melanoma 2C30 Skin 7.49E-02 3.77E-01 4.19E-01
Multiple myeloma 2A83.1 Peripheral blood 7.08E-01 -3.76E-02 -1.42E-01
Multiple myeloma 2A83.1 Bone marrow 2.62E-04 4.10E-01 2.07E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.75E-01 6.15E-02 2.34E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.56E-02 -1.42E-01 -5.93E-01
Myelofibrosis 2A20.2 Whole blood 1.25E-01 1.04E-01 8.92E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.76E-01 1.49E-01 2.23E-01
Myopathy 8C70.6 Muscle tissue 1.17E-02 1.46E-01 1.24E+00
Neonatal sepsis KA60 Whole blood 8.70E-01 -3.12E-02 -1.38E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.14E-07 -1.02E+00 -4.12E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.53E-02 -1.07E-01 -9.47E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.75E-03 1.84E-01 1.34E+00
Olive pollen allergy CA08.00 Peripheral blood 1.60E-01 4.02E-01 7.45E-01
Oral cancer 2B6E Oral tissue 4.64E-02 -1.88E-01 -6.69E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.69E-01 1.12E-01 1.08E-01
Osteoporosis FB83.1 Bone marrow 6.35E-01 1.28E-01 3.50E-01
Ovarian cancer 2C73 Ovarian tissue 8.74E-03 2.11E-01 8.43E-01
Pancreatic cancer 2C10 Pancreas 2.24E-02 2.82E-01 7.85E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 6.19E-04 -2.21E-01 -1.70E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.47E-05 1.87E-01 1.35E+00
Pituitary cancer 2D12 Pituitary tissue 5.72E-02 1.75E-01 6.68E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.13E-02 2.41E-01 7.79E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.08E-01 -3.39E-02 -2.93E-01
Polycythemia vera 2A20.4 Whole blood 3.19E-01 -2.64E-02 -1.96E-01
Pompe disease 5C51.3 Biceps muscle 6.56E-01 1.28E-01 7.05E-01
Preterm birth KA21.4Z Myometrium 1.77E-01 -1.30E-01 -6.69E-01
Prostate cancer 2C82 Prostate 3.40E-03 -4.98E-01 -8.58E-01
Psoriasis EA90 Skin 6.74E-16 -5.20E-01 -9.81E-01
Rectal cancer 2B92 Rectal colon tissue 1.69E-01 2.41E-01 1.23E+00
Renal cancer 2C90-2C91 Kidney 6.69E-04 -2.37E-01 -9.80E-01
Retinoblastoma 2D02.2 Uvea 1.94E-02 5.59E-01 3.44E+00
Rheumatoid arthritis FA20 Synovial tissue 1.91E-05 9.54E-01 3.79E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.12E-03 -9.25E-02 -6.45E-01
Schizophrenia 6A20 Prefrontal cortex 7.01E-02 -1.52E-02 -7.58E-02
Schizophrenia 6A20 Superior temporal cortex 2.53E-02 -9.57E-02 -8.26E-01
Scleroderma 4A42.Z Whole blood 5.49E-01 7.18E-02 3.99E-01
Seizure 8A60-8A6Z Whole blood 5.50E-01 -1.41E-01 -7.43E-01
Sensitive skin EK0Z Skin 1.54E-01 -9.74E-02 -1.04E+00
Sepsis with septic shock 1G41 Whole blood 2.81E-03 -4.94E-02 -2.42E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.56E-01 -1.05E-01 -7.49E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.13E-03 2.51E-01 1.35E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 9.17E-01 9.26E-02 2.67E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.38E-01 6.52E-02 2.56E-01
Skin cancer 2C30-2C3Z Skin 2.82E-13 4.87E-01 1.02E+00
Thrombocythemia 3B63 Whole blood 6.59E-01 4.99E-02 4.03E-01
Thrombocytopenia 3B64 Whole blood 6.14E-01 1.75E-01 2.26E-01
Thyroid cancer 2D10 Thyroid 1.12E-01 -1.47E-01 -3.02E-01
Tibial muscular dystrophy 8C75 Muscle tissue 9.55E-03 1.86E-01 9.27E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.34E-01 3.13E-01 1.39E+00
Type 2 diabetes 5A11 Liver tissue 9.79E-02 -5.76E-02 -1.12E+00
Ureter cancer 2C92 Urothelium 9.63E-01 -4.02E-02 -1.55E-01
Uterine cancer 2C78 Endometrium tissue 6.57E-17 -6.39E-01 -6.45E-01
Vitiligo ED63.0 Skin 9.37E-01 -1.05E-02 -4.62E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Identification and characterisation of a new human glucose-6-phosphatase isoform. FEBS Lett. 2003 Sep 11;551(1-3):159-64.