Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEEG96X)

DME Name Oxysterol 7-alpha-hydroxylase (CYP39A1)
Synonyms Cytochrome P450 39A1; 24-hydroxycholesterol 7-alpha-hydroxylase; CYP39A1; hCYP39A1
Gene Name CYP39A1
UniProt ID
CP39A_HUMAN
INTEDE ID
DME0619
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
51302
EC Number EC: 1.14.14.26
Oxidoreductase
Oxygen paired donor oxidoreductase
Flavin/flavoprotein donor oxidoreductase
EC: 1.14.14.26
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MELISPTVIIILGCLALFLLLQRKNLRRPPCIKGWIPWIGVGFEFGKAPLEFIEKARIKY
GPIFTVFAMGNRMTFVTEEEGINVFLKSKKVDFELAVQNIVYRTASIPKNVFLALHEKLY
IMLKGKMGTVNLHQFTGQLTEELHEQLENLGTHGTMDLNNLVRHLLYPVTVNMLFNKSLF
STNKKKIKEFHQYFQVYDEDFEYGSQLPECLLRNWSKSKKWFLELFEKNIPDIKACKSAK
DNSMTLLQATLDIVETETSKENSPNYGLLLLWASLSNAVPVAFWTLAYVLSHPDIHKAIM
EGISSVFGKAGKDKIKVSEDDLENLLLIKWCVLETIRLKAPGVITRKVVKPVEILNYIIP
SGDLLMLSPFWLHRNPKYFPEPELFKPERWKKANLEKHSFLDCFMAFGSGKFQCPARWFA
LLEVQMCIILILYKYDCSLLDPLPKQSYLHLVGVPQPEGQCRIEYKQRI
Function
This enzyme involves in neural cholesterol clearance through bile acid synthesis. And it catalyzes 7-alpha hydroxylation of (24S)-hydroxycholesterol, a neural oxysterol that is metabolized to bile acids in the liver.
KEGG Pathway
Primary bile acid biosynthesis (hsa00120 )
Reactome Pathway
Synthesis of bile acids and bile salts via 24-hydroxycholesterol (R-HSA-193775 )
Endogenous sterols (R-HSA-211976 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
CS-6969 DM8W7VL N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 8.41E-01 -1.16E-02 -8.46E-02
Alzheimer's disease 8A20 Entorhinal cortex 2.87E-01 1.49E-02 4.17E-02
Asthma CA23 Nasal and bronchial airway 1.78E-01 1.51E-01 1.86E-01
Behcet's disease 4A62 Peripheral blood 3.46E-01 -1.28E-01 -8.53E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.20E-01 4.38E-02 2.01E-01
Bladder cancer 2C94 Bladder tissue 6.89E-04 -2.39E+00 -2.93E+00
Breast cancer 2C60-2C6Z Breast tissue 3.23E-35 -1.35E+00 -1.40E+00
Colon cancer 2B90 Colon tissue 1.06E-84 1.64E+00 2.94E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.67E-01 -3.38E-01 -7.77E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.91E-01 3.79E-02 3.42E-01
Gastric cancer 2B72 Gastric tissue 2.08E-01 5.64E-01 9.23E-01
Glioblastopma 2A00.00 Nervous tissue 5.52E-30 4.02E-02 7.17E-02
Head and neck cancer 2D42 Head and neck tissue 7.14E-01 -2.96E-01 -3.23E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.31E-02 -2.79E-01 -6.71E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.09E-02 6.96E-01 1.47E+00
Interstitial cystitis GC00.3 Bladder tissue 4.20E-02 -3.92E-01 -2.28E+00
Ischemic stroke 8B11 Peripheral blood 1.38E-01 7.03E-02 5.81E-01
Liver cancer 2C12.0 Liver tissue 1.76E-33 -2.89E+00 -3.41E+00
Liver failure DB99.7-DB99.8 Liver tissue 3.66E-08 -4.51E+00 -1.13E+01
Lung cancer 2C25 Lung tissue 1.83E-25 -8.99E-01 -1.36E+00
Lupus erythematosus 4A40 Whole blood 1.26E-01 5.25E-02 1.80E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.68E-01 -3.86E-02 -1.72E-01
Multiple myeloma 2A83.1 Bone marrow 2.04E-02 -3.14E-01 -2.43E+00
Multiple myeloma 2A83.1 Peripheral blood 6.88E-02 1.33E-01 8.10E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.48E-01 3.66E-02 2.00E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.87E-06 9.79E-02 5.03E-01
Myocardial infarction BA41-BA50 Peripheral blood 9.02E-01 -2.87E-02 -4.82E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 8.20E-08 8.05E-01 2.28E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.66E-01 -1.20E-01 -1.31E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.26E-01 -4.11E-01 -6.63E-01
Olive pollen allergy CA08.00 Peripheral blood 4.52E-02 1.26E-01 1.86E+00
Oral cancer 2B6E Oral tissue 3.41E-01 4.78E-01 3.65E-01
Ovarian cancer 2C73 Ovarian tissue 5.90E-02 -9.22E-01 -1.00E+00
Pancreatic cancer 2C10 Pancreas 1.36E-01 -7.94E-01 -8.18E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.80E-02 1.93E-01 9.84E-01
Pituitary cancer 2D12 Pituitary tissue 9.98E-01 2.79E-01 5.07E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.32E-01 -1.79E-03 -9.06E-03
Pompe disease 5C51.3 Biceps muscle 6.81E-01 -2.15E-01 -4.40E-01
Prostate cancer 2C82 Prostate 3.75E-01 3.97E-01 3.73E-01
Psoriasis EA90 Skin 1.89E-21 -9.44E-01 -1.51E+00
Rectal cancer 2B92 Rectal colon tissue 3.92E-01 1.08E-01 1.59E-01
Renal cancer 2C90-2C91 Kidney 4.25E-02 -4.66E-01 -7.58E-01
Retinoblastoma 2D02.2 Uvea 3.22E-05 -2.23E+00 -1.21E+01
Schizophrenia 6A20 Prefrontal cortex 7.41E-01 -4.82E-02 -1.41E-01
Schizophrenia 6A20 Superior temporal cortex 6.47E-01 -3.62E-02 -2.67E-01
Scleroderma 4A42.Z Whole blood 8.66E-01 -1.17E-02 -6.20E-02
Seizure 8A60-8A6Z Whole blood 9.76E-01 6.62E-02 3.23E-01
Sepsis with septic shock 1G41 Whole blood 6.58E-03 4.38E-02 1.91E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.23E-01 -5.60E-04 -6.20E-03
Simpson golabi behmel syndrome LD2C Adipose tissue 4.34E-01 3.78E-02 1.44E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.27E-01 -3.76E-01 -8.12E-01
Skin cancer 2C30-2C3Z Skin 2.73E-95 -2.06E+00 -3.07E+00
Thrombocythemia 3B63 Whole blood 9.12E-01 3.80E-02 2.37E-01
Thrombocytopenia 3B64 Whole blood 6.69E-01 8.56E-02 5.20E-01
Thyroid cancer 2D10 Thyroid 2.97E-20 -9.69E-01 -1.44E+00
Tibial muscular dystrophy 8C75 Muscle tissue 4.09E-04 -4.96E-01 -1.31E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.12E-01 -1.42E-01 -9.98E-01
Type 2 diabetes 5A11 Liver tissue 1.53E-01 1.70E-01 6.44E-01
Ureter cancer 2C92 Urothelium 4.97E-01 -1.90E-01 -8.46E-01
Uterine cancer 2C78 Endometrium tissue 2.13E-17 9.84E-01 1.21E+00
Vitiligo ED63.0 Skin 8.40E-01 -9.35E-02 -3.26E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 61 Diseases

References

1 Association of CYP39A1, RUNX2 and oxidized alpha-1 antitrypsin expression in relation to cholangiocarcinoma progression. Asian Pac J Cancer Prev. 2014;15(23):10187-92.