Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEEHWOG)

DME Name	Azoreductase (azoR)
Synonyms	Azo-dye reductase; FMN-dependent NADH-azo compound oxidoreductase; FMN-dependent NADH-azoreductase; azoR; JW1409; acpD; b1412
Gene Name	azoR
UniProt ID	AZOR_ECOLI
INTEDE ID	DME1096
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Gene ID	947569
EC Number	EC: 1.7.1.6 Oxidoreductase Cytochrome acceptor oxidoreductase NAD/NADP acceptor oxidoreductase EC: 1.7.1.6
Lineage	Species: Escherichia coli Kingdom: Bacteria Phylum: Proteobacteria Class: Gammaproteobacteria Order: Enterobacterales Family: Enterobacteriaceae Genus: Escherichia Species: Escherichia coli
Tissue Distribution	Primarily distributed in human gut.
Sequence	MSKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALR PSDAPLTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFR YTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYG PEMAAKAQSDAKAAIDSIVSA
Function	This enzyme catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. And it requires NADH, but not NADPH, as an electron donor for its activity. And it can reduce ethyl red and methyl red, but is not able to convert sulfonated azo dyes.

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DME

1 Approved Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Balsalazide	DM7I1T9	Inflammatory bowel disease	DD72	Approved	[1]
------------------------------------------------------------------------------------

2 Clinical Trial Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
CTK0H-9987	DMSGYNP	N. A.	N. A.	Phase 2	[2]
SC-47085	DMGH4Q0	N. A.	N. A.	Phase 2	[3]
------------------------------------------------------------------------------------

1 Discontinued Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
CB1954	DMVP4YK	Solid tumour/cancer	2A00-2F9Z	Discontinued in Phase 2	[4]
------------------------------------------------------------------------------------

1 Investigative Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Ipsalazide	DMYEM59	N. A.	N. A.	Investigative	[1]
------------------------------------------------------------------------------------

References

1	Studies of two novel sulfasalazine analogs, ipsalazide and balsalazide. Dig Dis Sci. 1983 Jul;28(7):609-15.
2	The role of the gut flora in the metabolism of prontosil and neoprontosil in the rat. Xenobiotica. 1971 Mar;1(2):143-56.
3	Olsalazine. A review of its pharmacodynamic and pharmacokinetic properties, and therapeutic potential in inflammatory bowel disease. Drugs. 1991 Apr;41(4):647-64.
4	Discovery and evaluation of Escherichia coli nitroreductases that activate the anti-cancer prodrug CB1954. Biochem Pharmacol. 2010 Mar 1;79(5):678-87.