Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEFZWAX)

DME Name Uridine phosphorylase 1 (UPP1)
Synonyms Pyrimidine nucleoside phosphorylase 1; Uridinephosphorylase 1; UrdPase 1; UPase 1; UPP1
Gene Name UPP1
UniProt ID
UPP1_HUMAN
INTEDE ID
DME0139
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
7378
EC Number EC: 2.4.2.3
Transferase
Glycosyltransferases
Pentosyltransferase
EC: 2.4.2.3
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGG
SPSRMKAFIRCVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLH
ELIKLLYYARCSNVTIIRIGTSGGIGLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKT
DLNKKLVQELLLCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAY
AAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVS
YFIKKKLSKA
Function This enzyme catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate.
KEGG Pathway
Drug metabolism - other enzymes (hsa00983 )
Metabolic pathways (hsa01100 )
Pyrimidine metabolism (hsa00240 )
Reactome Pathway
Pyrimidine salvage (R-HSA-73614 )
Pyrimidine catabolism (R-HSA-73621 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Fluorouracil DMUM7HZ Adenocarcinoma 2D40 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.46E-06 -4.10E-01 -5.78E-01
Alopecia ED70 Skin from scalp 4.65E-04 2.20E-01 5.58E-01
Alzheimer's disease 8A20 Entorhinal cortex 3.99E-02 2.02E-01 5.48E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.64E-01 -1.37E-01 -4.29E-01
Aortic stenosis BB70 Calcified aortic valve 9.34E-01 8.67E-02 1.02E-01
Apnea 7A40 Hyperplastic tonsil 6.53E-01 -2.14E-01 -1.73E-01
Arthropathy FA00-FA5Z Peripheral blood 2.92E-01 1.61E-02 6.51E-02
Asthma CA23 Nasal and bronchial airway 3.36E-07 7.28E-01 6.40E-01
Atopic dermatitis EA80 Skin 2.15E-10 5.77E-01 2.96E+00
Autism 6A02 Whole blood 6.15E-01 -1.27E-02 -3.34E-02
Autoimmune uveitis 9A96 Peripheral monocyte 3.25E-01 -1.31E-01 -2.56E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.60E-04 1.84E+00 3.12E+00
Bacterial infection of gingival 1C1H Gingival tissue 1.89E-01 -1.98E-02 -3.46E-02
Batten disease 5C56.1 Whole blood 9.07E-01 2.88E-02 2.29E-01
Behcet's disease 4A62 Peripheral blood 3.49E-01 -1.38E-02 -5.90E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.59E-01 1.12E-01 3.27E-01
Bladder cancer 2C94 Bladder tissue 1.29E-04 1.01E+00 2.45E+00
Breast cancer 2C60-2C6Z Breast tissue 2.07E-09 2.27E-01 3.26E-01
Cardioembolic stroke 8B11.20 Whole blood 5.51E-04 2.09E-01 9.45E-01
Cervical cancer 2C77 Cervical tissue 5.52E-04 -1.12E+00 -7.99E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.41E-01 1.23E-02 3.44E-02
Chronic hepatitis C 1E51.1 Whole blood 5.76E-01 1.85E-01 4.95E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 9.25E-01 -1.44E-02 -2.52E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.57E-02 3.21E-01 5.13E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.48E-01 1.90E-01 6.38E-01
Colon cancer 2B90 Colon tissue 4.16E-29 -7.49E-01 -1.24E+00
Coronary artery disease BA80-BA8Z Peripheral blood 6.98E-01 3.54E-03 2.22E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.53E-01 -1.47E-01 -1.97E-01
Endometriosis GA10 Endometrium tissue 9.58E-01 1.29E-01 9.35E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.04E-02 2.02E-01 9.41E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.83E-05 2.95E-01 1.09E+00
Gastric cancer 2B72 Gastric tissue 6.69E-02 1.88E+00 2.09E+00
Glioblastopma 2A00.00 Nervous tissue 1.96E-03 -1.74E-01 -2.84E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 8.56E-02 -6.24E-01 -2.40E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.12E-03 1.15E+00 1.81E+00
Head and neck cancer 2D42 Head and neck tissue 2.85E-12 1.37E+00 7.31E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.97E-01 8.47E-02 2.69E-01
Huntington's disease 8A01.10 Whole blood 6.07E-01 4.34E-02 2.99E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.83E-01 -1.59E-01 -2.31E-01
Immunodeficiency 4A00-4A20 Peripheral blood 3.00E-01 1.28E-01 1.66E+00
Influenza 1E30 Whole blood 3.95E-01 -1.65E-01 -3.26E-01
Interstitial cystitis GC00.3 Bladder tissue 4.04E-03 4.23E-01 4.52E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.75E-01 7.17E-01 8.21E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.97E-03 7.68E-02 1.68E-01
Ischemic stroke 8B11 Peripheral blood 7.79E-01 -9.41E-02 -4.12E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.29E-02 8.27E-02 3.16E-01
Lateral sclerosis 8B60.4 Skin 6.65E-01 -5.44E-02 -1.08E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.64E-01 2.58E-01 3.41E-01
Liver cancer 2C12.0 Liver tissue 6.03E-02 -2.28E-01 -4.08E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.75E-03 8.48E-01 1.65E+00
Lung cancer 2C25 Lung tissue 1.67E-03 3.23E-01 4.69E-01
Lupus erythematosus 4A40 Whole blood 6.15E-06 5.59E-01 5.75E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.33E-01 -7.88E-02 -2.18E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.70E-02 8.39E-02 3.46E-01
Melanoma 2C30 Skin 2.98E-06 1.58E+00 1.37E+00
Multiple myeloma 2A83.1 Peripheral blood 4.38E-01 -1.93E-01 -8.28E-01
Multiple myeloma 2A83.1 Bone marrow 2.03E-10 1.29E+00 7.94E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.05E-01 4.28E-01 1.24E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.92E-01 2.49E-01 1.91E-01
Myelofibrosis 2A20.2 Whole blood 4.20E-01 2.71E-03 1.24E-02
Myocardial infarction BA41-BA50 Peripheral blood 2.35E-02 3.78E-01 5.19E-01
Myopathy 8C70.6 Muscle tissue 2.95E-02 2.86E-01 9.65E-01
Neonatal sepsis KA60 Whole blood 1.43E-51 1.54E+00 3.71E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.06E-01 1.52E-01 6.29E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 1.45E-01 5.84E-01 1.54E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.23E-01 -3.11E-01 -2.73E-01
Olive pollen allergy CA08.00 Peripheral blood 5.10E-02 -6.10E-01 -1.29E+00
Oral cancer 2B6E Oral tissue 9.31E-02 5.24E-01 3.25E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.21E-01 6.46E-01 6.03E-01
Osteoporosis FB83.1 Bone marrow 3.18E-01 4.00E-01 5.72E-01
Ovarian cancer 2C73 Ovarian tissue 2.89E-02 1.22E+00 1.27E+00
Pancreatic cancer 2C10 Pancreas 9.31E-01 4.30E-02 5.73E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 6.43E-01 -1.23E-01 -5.72E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.39E-05 6.15E-01 1.25E+00
Pituitary cancer 2D12 Pituitary tissue 3.78E-02 7.19E-01 1.05E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.10E-02 1.09E+00 1.53E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.24E-01 -6.20E-02 -3.74E-01
Polycythemia vera 2A20.4 Whole blood 2.05E-05 1.27E-01 5.81E-01
Pompe disease 5C51.3 Biceps muscle 3.47E-04 1.52E+00 2.03E+00
Preterm birth KA21.4Z Myometrium 1.30E-01 -2.98E-01 -2.01E-01
Prostate cancer 2C82 Prostate 5.52E-01 7.38E-01 5.68E-01
Psoriasis EA90 Skin 5.37E-43 2.29E+00 3.75E+00
Rectal cancer 2B92 Rectal colon tissue 2.78E-02 -2.12E-01 -1.11E+00
Renal cancer 2C90-2C91 Kidney 2.73E-06 9.82E-01 2.68E+00
Retinoblastoma 2D02.2 Uvea 9.63E-01 -1.07E-01 -1.77E-01
Rheumatoid arthritis FA20 Synovial tissue 2.59E-04 1.14E+00 2.44E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.99E-01 8.83E-02 1.77E-01
Schizophrenia 6A20 Prefrontal cortex 3.78E-02 1.24E-01 1.56E-01
Schizophrenia 6A20 Superior temporal cortex 5.32E-01 -9.11E-03 -5.01E-02
Scleroderma 4A42.Z Whole blood 2.12E-07 8.07E-01 3.94E+00
Seizure 8A60-8A6Z Whole blood 1.73E-01 5.33E-01 9.60E-01
Sensitive skin EK0Z Skin 3.11E-01 1.91E-01 8.80E-01
Sepsis with septic shock 1G41 Whole blood 1.05E-172 2.05E+00 5.06E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.83E-01 -8.61E-02 -1.32E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.00E-02 4.24E-01 7.49E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.14E-02 1.98E+00 1.97E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.98E-01 1.35E-01 9.78E-01
Skin cancer 2C30-2C3Z Skin 1.24E-119 2.66E+00 3.50E+00
Thrombocythemia 3B63 Whole blood 6.41E-02 -1.44E-01 -6.45E-01
Thrombocytopenia 3B64 Whole blood 2.43E-01 4.47E-01 4.73E-01
Thyroid cancer 2D10 Thyroid 3.21E-71 1.71E+00 3.61E+00
Tibial muscular dystrophy 8C75 Muscle tissue 8.65E-03 -4.00E-01 -8.96E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.19E-01 3.50E-01 1.20E+00
Type 2 diabetes 5A11 Liver tissue 1.97E-01 -1.65E-01 -4.65E-01
Ureter cancer 2C92 Urothelium 7.84E-01 -2.85E-02 -6.10E-02
Uterine cancer 2C78 Endometrium tissue 4.70E-01 3.02E-01 2.22E-01
Vitiligo ED63.0 Skin 7.75E-01 4.41E-02 2.09E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Uridine phosphorylase in breast cancer: a new prognostic factor? Front Biosci. 2006 Sep 1;11:2759-66.