Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEGF70S)

DME Name Cyclic ADP-ribose hydrolase 1 (CD38)
Synonyms
ADP-ribosyl cyclase 1; ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1; 2'-phospho-ADP-ribosyl cyclase; 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase; 2'-phospho-cyclic-ADP-ribose transferase; ADPRC 1; CD38; T10; cADPr hydrolase 1
Gene Name CD38
UniProt ID
CD38_HUMAN
INTEDE ID
DME0538
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
952
EC Number EC: 3.2.2.6
Hydrolases
Glycosylase
N-Glycosyl compound glycosidase
EC: 3.2.2.6
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MANCEFSPVSGDKPCCRLSRRAQLCLGVSILVLILVVVLAVVVPRWRQQWSGPGTTKRFP
ETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCN
KILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDC
SNNPVSVFWKTVSRRFAEAACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEA
WVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI
Function This enzyme has cADPr hydrolase activity.
KEGG Pathway
Calcium signaling pathway (hsa04020 )
Hematopoietic cell lineage (hsa04640 )
Metabolic pathways (hsa01100 )
Nicotinate and nicotinamide metabolism (hsa00760 )
Oxytocin signaling pathway (hsa04921 )
Pancreatic secretion (hsa04972 )
Salivary secretion (hsa04970 )
Reactome Pathway
Nicotinate metabolism (R-HSA-196807 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Vitamin B3 DMQVRZH Chronic renal failure GB61.Z Approved [23]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
Vitamin B3 Chronic renal failure [GB61.Z] Approved Km = 5 microM [23]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.89E-03 1.49E-01 2.68E-01
Alopecia ED70 Skin from scalp 9.56E-01 1.14E-02 4.58E-02
Alzheimer's disease 8A20 Entorhinal cortex 7.95E-01 -1.51E-02 -5.31E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 5.22E-02 -1.42E-01 -6.87E-01
Aortic stenosis BB70 Calcified aortic valve 8.58E-01 -5.23E-02 -1.12E-01
Apnea 7A40 Hyperplastic tonsil 1.55E-01 9.03E-01 2.12E+00
Arthropathy FA00-FA5Z Peripheral blood 8.36E-01 -8.48E-02 -2.06E-01
Asthma CA23 Nasal and bronchial airway 3.38E-04 -5.80E-01 -6.09E-01
Atopic dermatitis EA80 Skin 1.07E-01 5.08E-02 8.63E-01
Autism 6A02 Whole blood 3.39E-01 2.07E-01 2.24E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.20E-01 -2.52E-01 -9.13E-01
Autosomal dominant monocytopenia 4B04 Whole blood 8.68E-01 1.22E-02 4.54E-02
Bacterial infection of gingival 1C1H Gingival tissue 1.60E-24 1.92E+00 2.39E+00
Batten disease 5C56.1 Whole blood 1.18E-01 -2.84E-01 -4.32E-01
Behcet's disease 4A62 Peripheral blood 4.71E-01 9.87E-02 2.01E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.13E-01 -8.31E-03 -3.48E-02
Bladder cancer 2C94 Bladder tissue 4.31E-05 4.41E-01 1.60E+00
Breast cancer 2C60-2C6Z Breast tissue 1.84E-11 -4.54E-02 -9.13E-02
Cardioembolic stroke 8B11.20 Whole blood 3.09E-02 -1.36E-01 -5.06E-01
Cervical cancer 2C77 Cervical tissue 4.74E-07 2.24E-01 9.77E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.07E-01 -1.22E-01 -1.22E-01
Chronic hepatitis C 1E51.1 Whole blood 1.35E-01 2.04E-01 7.30E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.62E-01 1.73E-01 2.36E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.43E-01 -2.46E-02 -5.15E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.61E-01 -1.45E-01 -3.77E-01
Colon cancer 2B90 Colon tissue 7.69E-05 -3.45E-01 -5.79E-01
Coronary artery disease BA80-BA8Z Peripheral blood 2.84E-01 1.16E-01 2.47E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.70E-01 1.88E-01 4.37E-01
Endometriosis GA10 Endometrium tissue 6.57E-02 1.09E-01 3.06E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.01E-01 -3.74E-01 -5.77E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.90E-01 -3.62E-01 -1.21E+00
Gastric cancer 2B72 Gastric tissue 5.70E-01 8.87E-01 5.95E-01
Glioblastopma 2A00.00 Nervous tissue 7.70E-65 4.97E-01 1.26E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.06E-01 2.73E-01 1.14E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.28E-01 -2.90E-01 -5.90E-01
Head and neck cancer 2D42 Head and neck tissue 4.42E-01 -4.57E-01 -3.95E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.96E-01 -3.77E-02 -1.47E-01
Huntington's disease 8A01.10 Whole blood 8.44E-01 -4.98E-02 -1.16E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.37E-01 5.01E-01 8.53E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.13E-05 1.28E+00 6.59E+00
Influenza 1E30 Whole blood 1.80E-01 8.02E-01 9.07E-01
Interstitial cystitis GC00.3 Bladder tissue 1.98E-05 3.09E+00 4.42E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.08E-03 9.68E-01 5.94E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.51E-01 3.14E-02 8.36E-02
Ischemic stroke 8B11 Peripheral blood 6.20E-02 -4.63E-01 -5.87E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.41E-02 -2.31E-01 -3.19E-01
Lateral sclerosis 8B60.4 Skin 3.01E-02 1.97E-01 2.29E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 4.87E-01 1.20E-01 6.00E-01
Liver cancer 2C12.0 Liver tissue 1.98E-03 -4.62E-01 -6.91E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.42E-06 2.07E+00 3.25E+00
Lung cancer 2C25 Lung tissue 5.15E-15 7.17E-01 8.10E-01
Lupus erythematosus 4A40 Whole blood 2.85E-03 4.95E-01 5.19E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.71E-02 -9.08E-02 -3.95E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.87E-01 -9.99E-02 -2.57E-01
Melanoma 2C30 Skin 8.97E-06 6.21E-01 9.55E-01
Multiple myeloma 2A83.1 Peripheral blood 5.86E-01 -7.15E-01 -8.48E-01
Multiple myeloma 2A83.1 Bone marrow 8.33E-02 2.18E-01 6.95E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.30E-01 -1.65E-01 -4.72E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.66E-04 -2.21E-01 -4.69E-01
Myelofibrosis 2A20.2 Whole blood 1.05E-01 -6.39E-02 -2.56E-01
Myocardial infarction BA41-BA50 Peripheral blood 7.46E-01 -1.33E-01 -2.46E-01
Myopathy 8C70.6 Muscle tissue 1.91E-01 -3.59E-01 -7.61E-01
Neonatal sepsis KA60 Whole blood 2.35E-01 -3.52E-01 -4.92E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.61E-04 -7.24E-01 -1.95E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.69E-01 1.21E-01 3.80E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.46E-01 9.39E-03 5.16E-02
Olive pollen allergy CA08.00 Peripheral blood 1.31E-01 1.79E-01 1.04E+00
Oral cancer 2B6E Oral tissue 2.27E-06 9.54E-01 1.31E+00
Osteoarthritis FA00-FA0Z Synovial tissue 5.89E-01 -9.07E-02 -1.30E-01
Osteoporosis FB83.1 Bone marrow 5.71E-01 -3.92E-02 -6.38E-01
Ovarian cancer 2C73 Ovarian tissue 6.40E-03 3.67E-01 7.53E-01
Pancreatic cancer 2C10 Pancreas 2.00E-01 5.49E-01 4.98E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.27E-01 -8.61E-02 -2.13E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.13E-01 3.63E-01 1.49E+00
Pituitary cancer 2D12 Pituitary tissue 2.26E-03 -5.40E-01 -1.31E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.62E-04 -6.82E-01 -1.94E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.37E-02 3.02E-01 1.23E+00
Polycythemia vera 2A20.4 Whole blood 7.98E-01 -6.43E-02 -2.45E-01
Pompe disease 5C51.3 Biceps muscle 1.66E-06 -1.32E+00 -3.83E+00
Preterm birth KA21.4Z Myometrium 2.25E-02 -2.10E-01 -7.65E-01
Prostate cancer 2C82 Prostate 7.05E-03 -1.18E+00 -7.15E-01
Psoriasis EA90 Skin 9.26E-03 6.05E-02 1.72E-01
Rectal cancer 2B92 Rectal colon tissue 4.84E-03 -9.72E-01 -2.00E+00
Renal cancer 2C90-2C91 Kidney 2.24E-04 4.62E-01 1.08E+00
Retinoblastoma 2D02.2 Uvea 7.30E-03 7.33E-01 5.01E+00
Rheumatoid arthritis FA20 Synovial tissue 8.15E-01 3.44E-01 3.80E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.57E-02 2.18E-02 3.54E-02
Schizophrenia 6A20 Prefrontal cortex 1.17E-01 3.23E-02 4.09E-02
Schizophrenia 6A20 Superior temporal cortex 1.96E-01 -6.26E-02 -6.77E-01
Scleroderma 4A42.Z Whole blood 4.16E-02 -4.45E-01 -9.62E-01
Seizure 8A60-8A6Z Whole blood 9.59E-01 3.26E-01 4.05E-01
Sensitive skin EK0Z Skin 5.09E-01 7.19E-02 2.90E-01
Sepsis with septic shock 1G41 Whole blood 2.95E-03 -3.08E-01 -4.86E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.34E-02 -6.04E-01 -1.55E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.35E-01 -1.17E-01 -2.84E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 2.41E-01 -1.30E-02 -5.39E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.25E-01 1.43E-02 2.12E-02
Skin cancer 2C30-2C3Z Skin 4.59E-44 6.15E-01 1.73E+00
Thrombocythemia 3B63 Whole blood 6.89E-01 -4.57E-02 -1.73E-01
Thrombocytopenia 3B64 Whole blood 7.92E-01 3.72E-02 7.68E-02
Thyroid cancer 2D10 Thyroid 2.41E-01 -1.76E-01 -1.44E-01
Tibial muscular dystrophy 8C75 Muscle tissue 4.31E-03 -8.21E-01 -9.05E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.14E-02 6.44E-01 4.66E+00
Type 2 diabetes 5A11 Liver tissue 2.56E-01 2.10E-01 6.63E-01
Ureter cancer 2C92 Urothelium 8.97E-01 5.41E-02 2.61E-01
Uterine cancer 2C78 Endometrium tissue 1.20E-06 2.26E-01 5.51E-01
Vitiligo ED63.0 Skin 3.93E-01 -1.66E-02 -8.96E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Cyclic ADP-ribose hydrolase 1 (CD38) DTT Info
DME DTT Type Successful
1 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Daratumumab DMKCIUZ Multiple myeloma 2A83 Approved [1]
21 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Mezagitamab DMWJXFO Myasthenia gravis 8C6Y Phase 2 [2]
4SCAR19 and 4SCAR38 DMZKFU7 B-cell lymphoma 2A86 Phase 1/2 [3]
Anti-CD38 CAR-T cells DMTVXBY Multiple myeloma 2A83 Phase 1/2 [4]
CD38 and BCMA CAR-T Cells DMFZS8A Multiple myeloma 2A83 Phase 1/2 [5]
CD38 CAR T cells DMPS3I6 Multiple myeloma 2A83 Phase 1/2 [6]
CD38 CAR-T Cell DM0USBX Acute lymphoblastic leukaemia 2A85 Phase 1/2 [7]
CD38-specific gene-engineered T cells DMCH98G Acute myeloid leukaemia 2A60 Phase 1/2 [8]
ISB 1342 DMG107N Multiple myeloma 2A83 Phase 1/2 [9]
MOR-202 DMR8AHJ Multiple myeloma 2A83 Phase 1/2 [10]
SAR-650984 DMD20YH Haematological malignancy 2B33.Y Phase 1/2 [11]
225Ac-labelled aCD38 DM3E2IY Multiple myeloma 2A83 Phase 1 [12]
AMG 424 DMLAP8F Multiple myeloma 2A83 Phase 1 [13]
CART-38 cells DMKN8XD Acute myeloid leukaemia 2A60 Phase 1 [14]
CD38 CAR-T DMNX0V7 Multiple myeloma 2A83 Phase 1 [15]
KP1237 DMCGY7Q Multiple myeloma 2A83 Phase 1 [16]
SAR442085 DM5UXAB Plasma cell myeloma 2A83.1 Phase 1 [17]
SAR442257 DMXD5QP Malignant neoplasm 2A00-2F9Z Phase 1 [17]
SAR444559 DM4OMYQ Inflammation 1A00-CA43.1 Phase 1 [18]
TAK-169 DMRINBJ Multiple myeloma 2A83 Phase 1 [19]
TAK-573 DMUXAP1 Multiple myeloma 2A83 Phase 1 [20]
CAR-T cells targeting CD38 DMH5C37 Multiple myeloma 2A83 Clinical trial [21]
⏷ Show the Full List of 21 Clinical Trial Drug(s)
1 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
HuMax-CD38b DM4FIZJ Solid tumour/cancer 2A00-2F9Z Investigative [22]

References

1 Targeting CD38 with Daratumumab Monotherapy in Multiple Myeloma. N Engl J Med. 2015 Sep 24;373(13):1207-19.
2 Safety, tolerability, pharmacokinetics and pharmacodynamics of the anti-CD38 cytolytic antibody TAK-079 in healthy subjects. Br J Clin Pharmacol. 2020 Jul;86(7):1314-1325.
3 ClinicalTrials.gov (NCT03125577) Combination CAR-T Cell Therapy Targeting Hematological Malignancies
4 ClinicalTrials.gov (NCT03464916) Study to Evaluate the Safety and Efficacy of Anti-CD38 CAR-T in Relapsed or Refractory Multiple Myeloma Patients
5 ClinicalTrials.gov (NCT03767751) A Feasibility and Safety Study of Dual Specificity CD38 and BCMA CAR-T Cell Immunotherapy for Relapsed or Refractory Multiple Myeloma
6 ClinicalTrials.gov (NCT03271632) Multi-CAR T Cell Therapy in the Treatment of Multiple Myeloma
7 ClinicalTrials.gov (NCT03754764) A Feasibility and Safety Study of CD38 CAR-T Cell Immunotherapy for Relapsed B-cell Acute Lymphoblastic Leukemia After CD19 CAR-T Adoptive Cellular Immunotherapy
8 ClinicalTrials.gov (NCT03222674) Multi-CAR T Cell Therapy for Acute Myeloid Leukemia
9 Clinical pipeline report, company report or official report of Ichnos Sciences.
10 Clinical pipeline report, company report or official report of MorphoSys.
11 Clinical pipeline report, company report or official report of Sanofi-Aventis.
12 Radiopharmaceutical therapy in cancer: clinical advances and challenges. Nat Rev Drug Discov. 2020 Sep;19(9):589-608.
13 Clinical pipeline report, company report or official report of Amgen.
14 ClinicalTrials.gov (NCT03291444) CAR-T Cells Combined With Peptide Specific Dendritic Cell in Relapsed/Refractory Leukemia/MDS
15 Clinical pipeline report, company report or official report of Sorrento Therapeutics.
16 ClinicalTrials.gov (NCT04634435) A Phase 1 Study of Autologous Memory-like Natural Killer (NK) Cell Immunotherapy With BHV-1100 (Formerly KP1237) and IVIG Followed by Low Dose IL-2 as Early Post-Autologous Transplant Consolidation in Minimal Residual Disease Positive, Multiple Myeloma (MM) Patients in First or Second Remission. U.S.National Institutes of Health.
17 Clinical pipeline report, company report or official report of Sanofi.
18 Clinical pipeline report, company report or official report of Sanofi
19 Clinical pipeline report, company report or official report of Molecular Templates.
20 Clinical pipeline report, company report or official report of Takeda.
21 ClinicalTrials.gov (NCT03473457) CAR-T Cells Therapy in Relapsed/Refractory Acute Myeloid Leukemia
22 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2766).
23 ADP-ribosyl cyclase and CD38 catalyze the synthesis of a calcium-mobilizing metabolite from NADP. J Biol Chem. 1995 Dec 22;270(51):30327-33.