Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEGKWJB)

DME Name Alpha-methylacyl-CoA racemase (AMACR)
Synonyms Methylacyl-CoA racemase; 2-methylacyl-CoA racemase; 2-methylacyl-CoA 2-epimerase; AMACR; AMACRD; CBAS4; RACE; P504S
Gene Name AMACR
UniProt ID
AMACR_HUMAN
INTEDE ID
DME0116
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
23600
EC Number EC: 5.1.99.4
Isomerase
Racemase/epimerase
Racemase/epimerase
EC: 5.1.99.4
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MALQGISVVELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQP
RGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLA
GHDINYLALSGVLSKIGRSGENPYAPLNLLADFAGGGLMCALGIIMALFDRTRTGKGQVI
DANMVEGTAYLSSFLWKTQKLSLWEAPRGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQF
YELLIKGLGLKSDELPNQMSMDDWPEMKKKFADVFAEKTKAEWCQIFDGTDACVTPVLTF
EEVVHHDHNKERGSFITSEEQDVSPRPAPLLLNTPAIPSFKRDPFIGEHTEEILEEFGFS
REEIYQLNSDKIIESNKVKASL
Function This enzyme catalyzes the interconversion of (R)- and (S)-stereoisomers of alpha-methyl-branched-chain fatty acyl-CoA esters.
KEGG Pathway
Metabolic pathways (hsa01100 )
Peroxisome (hsa04146 )
Primary bile acid biosynthesis (hsa00120 )
Reactome Pathway
Peroxisomal protein import (R-HSA-9033241 )
Synthesis of bile acids and bile salts via 24-hydroxycholesterol (R-HSA-193775 )
Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol (R-HSA-193368 )
Beta-oxidation of pristanoyl-CoA (R-HSA-389887 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
2 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Dexibuprofen DMFYBD0 Ankylosing spondylitis FA92.0 Approved [1]
Ibuprofen DM8VCBE Dysmenorrhea GA34.3 Approved [2]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.12E-01 7.52E-03 3.88E-02
Alopecia ED70 Skin from scalp 2.17E-01 -1.99E-03 -5.28E-03
Alzheimer's disease 8A20 Entorhinal cortex 9.28E-01 -1.12E-02 -5.32E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 5.28E-02 1.27E-01 6.88E-01
Aortic stenosis BB70 Calcified aortic valve 8.87E-01 1.80E-02 5.96E-02
Apnea 7A40 Hyperplastic tonsil 9.22E-02 -1.58E-01 -1.28E+00
Arthropathy FA00-FA5Z Peripheral blood 2.58E-01 -2.72E-02 -1.07E-01
Asthma CA23 Nasal and bronchial airway 7.43E-01 8.15E-02 1.37E-01
Atopic dermatitis EA80 Skin 3.11E-05 -1.94E-01 -9.10E-01
Autism 6A02 Whole blood 8.78E-01 3.44E-02 1.77E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.32E-02 -2.03E-01 -1.32E+00
Autosomal dominant monocytopenia 4B04 Whole blood 8.26E-01 -1.24E-02 -7.67E-02
Bacterial infection of gingival 1C1H Gingival tissue 6.85E-03 -8.87E-02 -2.89E-01
Batten disease 5C56.1 Whole blood 4.21E-01 3.45E-02 1.75E-01
Behcet's disease 4A62 Peripheral blood 5.79E-01 -4.25E-02 -1.69E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.29E-01 3.80E-02 2.63E-01
Bladder cancer 2C94 Bladder tissue 2.31E-02 8.78E-02 3.74E-01
Breast cancer 2C60-2C6Z Breast tissue 7.56E-13 1.14E-01 4.24E-01
Cardioembolic stroke 8B11.20 Whole blood 1.73E-01 -7.92E-03 -3.77E-02
Cervical cancer 2C77 Cervical tissue 1.03E-03 -2.48E-01 -9.09E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.47E-01 -5.21E-02 -1.57E-01
Chronic hepatitis C 1E51.1 Whole blood 7.84E-01 4.39E-02 2.70E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.43E-01 -3.03E-02 -1.68E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.15E-02 1.21E-01 4.92E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.20E-01 7.97E-02 6.08E-01
Colon cancer 2B90 Colon tissue 2.17E-01 -3.94E-02 -1.31E-01
Coronary artery disease BA80-BA8Z Peripheral blood 6.33E-02 -1.38E-01 -1.42E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.98E-01 5.66E-02 2.99E-01
Endometriosis GA10 Endometrium tissue 6.13E-01 -1.67E-03 -5.16E-03
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.02E-01 -5.76E-02 -2.73E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.12E-01 -1.57E-01 -7.06E-01
Gastric cancer 2B72 Gastric tissue 8.84E-01 1.83E-01 2.82E-01
Glioblastopma 2A00.00 Nervous tissue 8.80E-01 2.66E-02 8.40E-02
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.69E-01 -1.31E-01 -1.71E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 7.50E-07 -7.86E-01 -3.11E+00
Head and neck cancer 2D42 Head and neck tissue 3.31E-01 -2.73E-02 -1.07E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.39E-01 -2.58E-02 -1.44E-01
Huntington's disease 8A01.10 Whole blood 4.56E-01 -1.49E-03 -7.67E-03
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.52E-01 -2.68E-02 -1.22E+00
Immunodeficiency 4A00-4A20 Peripheral blood 2.60E-01 -8.79E-02 -7.77E-01
Influenza 1E30 Whole blood 4.30E-01 1.13E-01 1.07E+00
Interstitial cystitis GC00.3 Bladder tissue 2.44E-01 0.00E+00 0.00E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.24E-02 -1.04E-01 -7.11E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.21E-01 -7.60E-02 -2.05E-01
Ischemic stroke 8B11 Peripheral blood 3.86E-01 -4.34E-02 -2.36E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.99E-01 -6.16E-03 -1.87E-02
Lateral sclerosis 8B60.4 Skin 4.78E-01 3.38E-03 1.15E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 2.67E-01 9.65E-02 6.54E-01
Liver cancer 2C12.0 Liver tissue 8.34E-03 -7.83E-02 -1.72E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.29E-01 -1.55E-01 -7.02E-01
Lung cancer 2C25 Lung tissue 7.29E-22 2.06E-01 8.20E-01
Lupus erythematosus 4A40 Whole blood 6.61E-01 -4.82E-03 -1.04E-02
Major depressive disorder 6A70-6A7Z Hippocampus 6.22E-01 2.18E-02 1.65E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.92E-01 -1.44E-02 -6.66E-02
Melanoma 2C30 Skin 7.80E-02 -6.84E-01 -7.17E-01
Multiple myeloma 2A83.1 Peripheral blood 1.36E-01 -2.00E-01 -8.49E-01
Multiple myeloma 2A83.1 Bone marrow 1.22E-01 -1.10E-01 -4.14E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.03E-01 1.20E-01 2.05E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.97E-01 -5.57E-03 -3.60E-02
Myelofibrosis 2A20.2 Whole blood 5.30E-01 1.00E-01 5.86E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.08E-01 5.01E-02 1.20E-01
Myopathy 8C70.6 Muscle tissue 5.28E-02 -1.65E-01 -6.96E-01
Neonatal sepsis KA60 Whole blood 1.32E-05 -1.11E-01 -4.66E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.98E-06 8.79E-01 3.19E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.80E-01 -9.06E-02 -3.39E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.85E-01 7.14E-02 9.32E-01
Olive pollen allergy CA08.00 Peripheral blood 1.37E-01 7.77E-02 1.05E+00
Oral cancer 2B6E Oral tissue 1.59E-02 -2.42E-01 -7.03E-01
Osteoarthritis FA00-FA0Z Synovial tissue 8.45E-02 -5.38E-01 -1.05E+00
Osteoporosis FB83.1 Bone marrow 1.31E-01 1.68E-01 9.03E-01
Ovarian cancer 2C73 Ovarian tissue 5.35E-01 -7.81E-02 -2.56E-01
Pancreatic cancer 2C10 Pancreas 9.31E-02 -1.26E-01 -3.22E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 6.64E-01 0.00E+00 0.00E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.11E-01 -6.31E-02 -4.45E-01
Pituitary cancer 2D12 Pituitary tissue 1.34E-03 4.06E-01 1.75E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.23E-02 2.34E-01 8.61E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.39E-01 -8.77E-02 -5.55E-01
Polycythemia vera 2A20.4 Whole blood 1.09E-01 -3.99E-02 -2.62E-01
Pompe disease 5C51.3 Biceps muscle 1.92E-03 -2.38E-01 -1.12E+00
Preterm birth KA21.4Z Myometrium 2.39E-01 -1.50E-01 -6.73E-01
Prostate cancer 2C82 Prostate 1.50E-26 2.26E+00 4.45E+00
Psoriasis EA90 Skin 4.79E-10 3.27E-01 9.82E-01
Rectal cancer 2B92 Rectal colon tissue 1.15E-01 -1.23E-01 -1.03E+00
Renal cancer 2C90-2C91 Kidney 1.58E-01 4.01E-01 8.22E-01
Retinoblastoma 2D02.2 Uvea 5.07E-02 8.22E-02 7.65E-01
Rheumatoid arthritis FA20 Synovial tissue 6.14E-04 -6.16E-01 -2.13E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.72E-01 -1.14E-02 -7.83E-02
Schizophrenia 6A20 Prefrontal cortex 3.32E-01 -3.26E-02 -1.44E-01
Schizophrenia 6A20 Superior temporal cortex 9.53E-01 -3.62E-02 -2.35E-01
Scleroderma 4A42.Z Whole blood 5.98E-07 8.72E-01 3.86E+00
Seizure 8A60-8A6Z Whole blood 3.09E-01 -7.09E-02 -4.21E-01
Sensitive skin EK0Z Skin 4.76E-01 0.00E+00 0.00E+00
Sepsis with septic shock 1G41 Whole blood 2.61E-01 -1.14E-02 -4.17E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.07E-02 -1.46E-01 -1.37E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.87E-01 -3.22E-02 -1.66E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.54E-01 -1.18E-02 -1.63E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.28E-01 -1.68E-02 -1.22E-01
Skin cancer 2C30-2C3Z Skin 1.48E-02 -4.35E-02 -8.08E-02
Thrombocythemia 3B63 Whole blood 4.22E-01 -7.89E-02 -5.36E-01
Thrombocytopenia 3B64 Whole blood 9.19E-02 -2.11E-01 -9.39E-01
Thyroid cancer 2D10 Thyroid 8.82E-03 7.21E-02 2.44E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.51E-08 -7.85E-01 -3.28E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.88E-01 6.92E-02 3.33E-01
Type 2 diabetes 5A11 Liver tissue 7.56E-01 -6.50E-02 -1.85E-01
Ureter cancer 2C92 Urothelium 1.65E-01 1.35E-01 5.56E-01
Uterine cancer 2C78 Endometrium tissue 6.49E-04 5.82E-02 2.04E-01
Vitiligo ED63.0 Skin 3.70E-01 -6.51E-02 -2.73E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Alpha-methylacyl-CoA racemase (AMACR) DTT Info
DME DTT Type Literature-reported

References

1 Alpha-Methylacyl-CoA racemase (AMACR): metabolic enzyme, drug metabolizer and cancer marker P504S. Prog Lipid Res. 2013 Apr;52(2):220-30.
2 Ibuprofen: pharmacology, efficacy and safety. Inflammopharmacology. 2009 Dec;17(6):275-342.