Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEH4TD6)

DME Name Selenocysteine lyase (SCLY)
Synonyms Selenocysteine beta-lyase; L-selenocysteine selenide-lyase; Selenocysteine reductase; SCL; SCLY; hSCL
Gene Name SCLY
UniProt ID
SCLY_HUMAN
INTEDE ID
DME0211
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
51540
EC Number EC: 4.4.1.16
Lyases
Carbon-sulfur lyase
Carbon-sulfur lyase
EC: 4.4.1.16
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MEAAVAPGRDAPAPAASQPSGCGKHNSPERKVYMDYNATTPLEPEVIQAMTKAMWEAWGN
PSSPYSAGRKAKDIINAARESLAKMIGGKPQDIIFTSGGTESNNLVIHSVVKHFHANQTS
KGHTGGHHSPVKGAKPHFITSSVEHDSIRLPLEHLVEEQVAAVTFVPVSKVSGQAEVDDI
LAAVRPTTRLVTIMLANNETGIVMPVPEISQRIKALNQERVAAGLPPILVHTDAAQALGK
QRVDVEDLGVDFLTIVGHKFYGPRIGALYIRGLGEFTPLYPMLFGGGQERNFRPGTENTP
MIAGLGKAAELVTQNCEAYEAHMRDVRDYLEERLEAEFGQKRIHLNSQFPGTQRLPNTCN
FSIRGPRLQGHVVLAQCRVLMASVGAACHSDHGDQPSPVLLSYGVPFDVARNALRLSVGR
STTRAEVDLVVQDLKQAVAQLEDQA
Function This enzyme catalyzes the decomposition of L-selenocysteine to L-alanine and elemental selenium.
KEGG Pathway
Metabolic pathways (hsa01100 )
Selenocompound metabolism (hsa00450 )
Reactome Pathway
Metabolism of ingested SeMet, Sec, MeSec into H2Se (R-HSA-2408508 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Selenium DM25CGV N. A. N. A. Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.62E-01 4.01E-02 1.67E-01
Alopecia ED70 Skin from scalp 8.13E-01 2.72E-03 1.01E-02
Alzheimer's disease 8A20 Entorhinal cortex 1.60E-01 -2.04E-02 -1.23E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.91E-01 0.00E+00 0.00E+00
Aortic stenosis BB70 Calcified aortic valve 9.97E-01 8.91E-02 1.47E-01
Apnea 7A40 Hyperplastic tonsil 1.04E-02 -3.69E-01 -1.84E+00
Arthropathy FA00-FA5Z Peripheral blood 9.90E-01 3.03E-02 1.96E-01
Asthma CA23 Nasal and bronchial airway 5.60E-01 -6.69E-05 -2.15E-04
Atopic dermatitis EA80 Skin 3.51E-02 -2.90E-02 -2.67E-01
Autism 6A02 Whole blood 2.93E-01 -8.51E-02 -4.04E-01
Autoimmune uveitis 9A96 Peripheral monocyte 8.19E-02 -1.47E-01 -1.04E+00
Autosomal dominant monocytopenia 4B04 Whole blood 8.23E-01 -2.68E-01 -6.68E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.25E-01 -5.64E-02 -2.16E-01
Batten disease 5C56.1 Whole blood 9.11E-01 -1.64E-02 -1.42E-01
Behcet's disease 4A62 Peripheral blood 5.78E-01 -4.17E-02 -1.35E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.03E-01 -5.56E-02 -3.43E-01
Bladder cancer 2C94 Bladder tissue 3.48E-02 3.08E-01 1.50E+00
Breast cancer 2C60-2C6Z Breast tissue 7.80E-01 2.89E-02 1.02E-01
Cardioembolic stroke 8B11.20 Whole blood 8.57E-01 1.07E-01 2.47E-01
Cervical cancer 2C77 Cervical tissue 3.40E-02 -1.43E-01 -5.75E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.31E-01 2.56E-02 8.95E-02
Chronic hepatitis C 1E51.1 Whole blood 7.38E-02 1.30E-01 6.94E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 6.20E-01 4.52E-02 1.78E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.22E-02 9.35E-02 4.18E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.23E-02 9.54E-02 1.28E+00
Colon cancer 2B90 Colon tissue 8.71E-05 1.07E-01 4.06E-01
Coronary artery disease BA80-BA8Z Peripheral blood 9.50E-01 1.08E-01 3.69E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.80E-01 1.34E-01 2.40E-01
Endometriosis GA10 Endometrium tissue 1.88E-01 6.43E-02 2.15E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.76E-01 7.07E-02 4.91E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.69E-01 -4.01E-03 -1.41E-02
Gastric cancer 2B72 Gastric tissue 5.23E-01 2.63E-04 1.56E-03
Glioblastopma 2A00.00 Nervous tissue 1.97E-02 -8.07E-02 -2.67E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 6.58E-01 7.26E-02 3.23E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.32E-05 3.85E-01 1.60E+00
Head and neck cancer 2D42 Head and neck tissue 4.05E-01 8.15E-03 4.01E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.20E-01 -8.50E-02 -3.51E-01
Huntington's disease 8A01.10 Whole blood 5.50E-01 4.10E-02 2.31E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.26E-01 1.27E-02 1.11E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.22E-01 -2.29E-03 -2.01E-02
Influenza 1E30 Whole blood 8.11E-01 -7.63E-02 -5.21E-01
Interstitial cystitis GC00.3 Bladder tissue 6.84E-01 5.16E-02 5.64E-01
Intracranial aneurysm 8B01.0 Intracranial artery 9.94E-01 -7.90E-02 -2.46E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 7.41E-01 3.74E-02 1.44E-01
Ischemic stroke 8B11 Peripheral blood 6.21E-01 7.16E-03 5.53E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 8.17E-03 -9.68E-02 -3.58E-01
Lateral sclerosis 8B60.4 Skin 5.59E-02 3.60E-01 1.63E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 6.46E-01 1.59E-01 5.04E-01
Liver cancer 2C12.0 Liver tissue 4.85E-04 -1.60E-01 -7.18E-01
Liver failure DB99.7-DB99.8 Liver tissue 3.52E-03 -3.73E-01 -2.08E+00
Lung cancer 2C25 Lung tissue 7.01E-05 8.05E-02 3.48E-01
Lupus erythematosus 4A40 Whole blood 2.57E-02 -1.39E-01 -2.42E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.63E-01 -1.23E-02 -7.50E-02
Major depressive disorder 6A70-6A7Z Whole blood 2.25E-01 7.30E-02 3.48E-01
Melanoma 2C30 Skin 1.90E-01 5.11E-01 6.71E-01
Multiple myeloma 2A83.1 Peripheral blood 2.47E-01 8.87E-02 5.37E-01
Multiple myeloma 2A83.1 Bone marrow 8.14E-02 9.35E-02 5.24E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.37E-01 -2.83E-01 -6.32E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.55E-01 7.50E-03 2.93E-02
Myelofibrosis 2A20.2 Whole blood 1.89E-01 4.48E-02 3.40E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.65E-01 7.91E-03 1.40E-02
Myopathy 8C70.6 Muscle tissue 6.43E-02 -1.06E-01 -5.09E-01
Neonatal sepsis KA60 Whole blood 1.13E-02 -5.85E-02 -2.27E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.08E-03 -3.50E-01 -1.18E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.92E-01 1.04E-02 9.89E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.17E-01 3.89E-02 1.93E-01
Olive pollen allergy CA08.00 Peripheral blood 3.29E-01 -7.30E-02 -4.52E-01
Oral cancer 2B6E Oral tissue 1.45E-07 3.12E-01 1.20E+00
Osteoarthritis FA00-FA0Z Synovial tissue 2.42E-01 2.66E-01 7.94E-01
Osteoporosis FB83.1 Bone marrow 1.19E-01 2.44E-01 1.12E+00
Ovarian cancer 2C73 Ovarian tissue 1.84E-02 1.67E-01 1.11E+00
Pancreatic cancer 2C10 Pancreas 2.76E-03 -3.82E-01 -1.05E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 8.49E-01 -8.23E-02 -3.87E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.55E-01 -1.40E-02 -9.95E-02
Pituitary cancer 2D12 Pituitary tissue 2.51E-04 3.44E-01 2.20E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.56E-04 3.90E-01 2.18E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.24E-01 3.20E-02 1.42E-01
Polycythemia vera 2A20.4 Whole blood 9.32E-01 1.70E-02 1.16E-01
Pompe disease 5C51.3 Biceps muscle 4.04E-01 -4.16E-02 -2.97E-01
Preterm birth KA21.4Z Myometrium 6.78E-02 -1.68E-01 -1.52E+00
Prostate cancer 2C82 Prostate 3.13E-05 -5.89E-01 -1.43E+00
Psoriasis EA90 Skin 3.82E-09 -2.16E-01 -5.96E-01
Rectal cancer 2B92 Rectal colon tissue 6.76E-01 -2.13E-01 -7.43E-01
Renal cancer 2C90-2C91 Kidney 7.28E-04 -3.81E-01 -1.50E+00
Retinoblastoma 2D02.2 Uvea 7.36E-01 3.92E-02 2.69E-01
Rheumatoid arthritis FA20 Synovial tissue 1.52E-05 3.60E-01 3.35E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.90E-01 1.36E-02 8.68E-02
Schizophrenia 6A20 Prefrontal cortex 1.14E-01 -7.07E-02 -2.98E-01
Schizophrenia 6A20 Superior temporal cortex 2.56E-01 -1.03E-01 -6.02E-01
Scleroderma 4A42.Z Whole blood 5.51E-03 1.74E-01 1.25E+00
Seizure 8A60-8A6Z Whole blood 4.07E-01 2.21E-02 1.30E-01
Sensitive skin EK0Z Skin 9.12E-01 -1.20E-02 -1.05E-01
Sepsis with septic shock 1G41 Whole blood 3.50E-04 -5.64E-02 -2.39E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.23E-01 1.20E-01 4.77E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.83E-01 -3.97E-02 -1.60E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.86E-01 4.05E-02 2.42E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.79E-01 8.24E-02 3.59E-01
Skin cancer 2C30-2C3Z Skin 6.59E-01 -4.72E-02 -1.10E-01
Thrombocythemia 3B63 Whole blood 1.36E-01 -5.75E-02 -4.50E-01
Thrombocytopenia 3B64 Whole blood 8.55E-01 1.04E-01 3.32E-01
Thyroid cancer 2D10 Thyroid 3.81E-07 1.48E-01 5.75E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.98E-01 -3.07E-02 -1.08E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.79E-01 1.74E-01 8.43E-01
Type 2 diabetes 5A11 Liver tissue 3.04E-01 -5.49E-02 -2.46E-01
Ureter cancer 2C92 Urothelium 8.94E-01 1.30E-03 6.35E-03
Uterine cancer 2C78 Endometrium tissue 5.42E-07 -1.70E-01 -4.96E-01
Vitiligo ED63.0 Skin 5.97E-01 -3.49E-04 -1.63E-03
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Selenium metabolism, selenoproteins and mechanisms of cancer prevention: complexities with thioredoxin reductase. Carcinogenesis. 1999 Sep;20(9):1657-66.