Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEHEZPI)

DME Name Cathepsin H (CTSH)
Synonyms Pro-cathepsin H; Cathepsin H heavy chain; Cathepsin H light chain; Cathepsin H mini chain; CPSB; CTSH
Gene Name CTSH
UniProt ID
CATH_HUMAN
INTEDE ID
DME0562
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1512
EC Number EC: 3.4.22.16
Hydrolases
Peptidase
Cysteine protease
EC: 3.4.22.16
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MWATLPLLCAGAWLLGVPVCGAAELCVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFAS
NWRKINAHNNGNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSV
DWRKKGNFVSPVKNQGACGSCWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHG
CQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMV
EAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVK
NSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLV
Function This enzyme is important for the overall degradation of proteins in lysosomes.
KEGG Pathway
Apoptosis (hsa04210 )
Lysosome (hsa04142 )
Reactome Pathway
Neutrophil degranulation (R-HSA-6798695 )
Surfactant metabolism (R-HSA-5683826 )
MHC class II antigen presentation (R-HSA-2132295 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
BRADYKININ DM4R6UV N. A. N. A. Phase 1 [2]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.44E-27 -1.24E+00 -2.41E+00
Alopecia ED70 Skin from scalp 5.43E-07 2.80E-01 1.06E+00
Alzheimer's disease 8A20 Entorhinal cortex 5.62E-08 3.92E-01 6.64E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 4.65E-01 -1.61E-01 -5.10E-01
Aortic stenosis BB70 Calcified aortic valve 5.43E-01 5.62E-01 4.53E-01
Apnea 7A40 Hyperplastic tonsil 1.67E-01 1.44E+00 1.85E+00
Arthropathy FA00-FA5Z Peripheral blood 9.91E-01 1.12E-01 4.25E-01
Asthma CA23 Nasal and bronchial airway 3.04E-04 -1.58E-01 -4.84E-01
Atopic dermatitis EA80 Skin 3.27E-06 -3.18E-01 -1.21E+00
Autism 6A02 Whole blood 4.03E-01 -1.08E-01 -2.90E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.78E-01 -9.80E-02 -2.30E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.98E-02 8.34E-01 1.94E+00
Bacterial infection of gingival 1C1H Gingival tissue 4.59E-22 1.11E+00 2.00E+00
Batten disease 5C56.1 Whole blood 8.24E-01 4.27E-02 9.95E-02
Behcet's disease 4A62 Peripheral blood 8.68E-01 5.92E-02 3.55E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.01E-01 2.56E-02 4.73E-02
Bladder cancer 2C94 Bladder tissue 2.95E-02 -3.13E-01 -6.80E-01
Breast cancer 2C60-2C6Z Breast tissue 4.70E-13 3.10E-01 6.80E-01
Cardioembolic stroke 8B11.20 Whole blood 1.10E-03 2.50E-01 1.04E+00
Cervical cancer 2C77 Cervical tissue 4.21E-02 -1.29E-01 -4.07E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.50E-01 -1.01E-02 -7.54E-03
Chronic hepatitis C 1E51.1 Whole blood 7.02E-01 -1.10E+00 -9.29E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.22E-01 -6.33E-02 -1.50E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.94E-01 -2.49E-02 -7.13E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.22E-01 -1.23E-01 -2.36E-01
Colon cancer 2B90 Colon tissue 6.06E-45 9.24E-01 1.63E+00
Coronary artery disease BA80-BA8Z Peripheral blood 2.68E-02 -9.09E-01 -3.00E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.43E-01 3.05E-02 1.14E-01
Endometriosis GA10 Endometrium tissue 3.01E-01 -2.50E-01 -1.76E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.10E-01 3.12E-02 5.43E-02
Familial hypercholesterolemia 5C80.00 Whole blood 2.90E-16 1.72E+00 2.09E+00
Gastric cancer 2B72 Gastric tissue 4.26E-01 4.86E-01 3.56E-01
Glioblastopma 2A00.00 Nervous tissue 5.92E-01 -8.46E-02 -1.10E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.55E-01 -9.22E-01 -1.12E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.08E-02 1.40E+00 9.56E-01
Head and neck cancer 2D42 Head and neck tissue 1.91E-03 -8.69E-01 -7.38E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.80E-01 4.22E-02 7.40E-02
Huntington's disease 8A01.10 Whole blood 3.47E-01 5.79E-03 8.41E-03
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.44E-01 -1.77E-02 -2.67E-02
Immunodeficiency 4A00-4A20 Peripheral blood 9.79E-04 1.01E+00 2.14E+00
Influenza 1E30 Whole blood 4.96E-01 -4.23E-01 -5.44E-01
Interstitial cystitis GC00.3 Bladder tissue 1.43E-02 -7.64E-01 -2.47E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.93E-02 1.34E+00 1.84E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.39E-01 -2.55E-01 -3.09E-01
Ischemic stroke 8B11 Peripheral blood 4.33E-01 -1.56E-01 -3.53E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.97E-07 -7.58E-01 -9.38E-01
Lateral sclerosis 8B60.4 Skin 6.28E-01 1.87E-02 7.86E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 7.14E-02 7.57E-01 1.15E+00
Liver cancer 2C12.0 Liver tissue 4.04E-02 7.60E-02 1.36E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.43E-03 1.33E+00 2.55E+00
Lung cancer 2C25 Lung tissue 6.20E-101 -1.13E+00 -2.78E+00
Lupus erythematosus 4A40 Whole blood 2.17E-05 2.34E-01 3.27E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.80E-01 -1.48E-01 -2.82E-01
Major depressive disorder 6A70-6A7Z Whole blood 8.42E-01 3.45E-02 3.73E-02
Melanoma 2C30 Skin 5.92E-02 2.41E-01 1.54E-01
Multiple myeloma 2A83.1 Peripheral blood 3.35E-01 2.84E-01 3.22E-01
Multiple myeloma 2A83.1 Bone marrow 3.66E-05 -2.96E+00 -3.90E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.00E-01 1.24E-01 3.99E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.46E-05 8.82E-01 9.97E-01
Myelofibrosis 2A20.2 Whole blood 7.86E-02 -4.03E-01 -1.03E+00
Myocardial infarction BA41-BA50 Peripheral blood 8.27E-01 -1.12E-01 -1.55E-01
Myopathy 8C70.6 Muscle tissue 7.67E-06 5.50E-01 2.11E+00
Neonatal sepsis KA60 Whole blood 4.95E-08 3.85E-01 6.83E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.84E-04 -9.76E-01 -1.66E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.34E-01 -1.89E-01 -2.69E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.02E-01 -1.03E-01 -2.48E-01
Olive pollen allergy CA08.00 Peripheral blood 9.91E-01 9.44E-02 5.47E-01
Oral cancer 2B6E Oral tissue 8.73E-04 1.14E+00 1.20E+00
Osteoarthritis FA00-FA0Z Synovial tissue 8.19E-01 8.40E-01 1.01E+00
Osteoporosis FB83.1 Bone marrow 9.64E-01 3.86E-01 3.42E-01
Ovarian cancer 2C73 Ovarian tissue 8.26E-02 2.89E-01 5.20E-01
Pancreatic cancer 2C10 Pancreas 1.22E-02 8.68E-01 1.02E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 4.25E-01 1.26E-01 4.59E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.42E-03 5.26E-01 8.51E-01
Pituitary cancer 2D12 Pituitary tissue 4.40E-01 -7.62E-02 -1.02E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.27E-01 3.50E-03 4.43E-03
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.48E-02 -1.39E-01 -5.26E-01
Polycythemia vera 2A20.4 Whole blood 1.07E-01 -2.04E-01 -5.28E-01
Pompe disease 5C51.3 Biceps muscle 1.68E-04 1.52E+00 2.29E+00
Preterm birth KA21.4Z Myometrium 8.83E-02 -5.04E-01 -6.99E-01
Prostate cancer 2C82 Prostate 1.73E-03 -1.48E-01 -2.90E-01
Psoriasis EA90 Skin 2.51E-02 -1.03E-01 -3.14E-01
Rectal cancer 2B92 Rectal colon tissue 2.60E-02 6.36E-01 1.67E+00
Renal cancer 2C90-2C91 Kidney 3.88E-04 -1.07E+00 -1.48E+00
Retinoblastoma 2D02.2 Uvea 2.22E-09 2.51E+00 1.04E+01
Rheumatoid arthritis FA20 Synovial tissue 5.31E-05 1.98E+00 3.31E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.55E-01 -2.06E-02 -7.17E-02
Schizophrenia 6A20 Prefrontal cortex 1.30E-01 1.57E-01 1.39E-01
Schizophrenia 6A20 Superior temporal cortex 4.89E-01 1.27E-02 2.83E-02
Scleroderma 4A42.Z Whole blood 8.90E-03 2.10E-01 7.61E-01
Seizure 8A60-8A6Z Whole blood 1.42E-01 1.66E-01 4.93E-01
Sensitive skin EK0Z Skin 4.36E-01 -8.89E-02 -4.80E-01
Sepsis with septic shock 1G41 Whole blood 4.02E-12 4.25E-01 8.33E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.63E-01 -2.01E-01 -6.43E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.90E-03 -7.81E-01 -1.19E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 7.59E-01 7.70E-02 4.69E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.28E-01 -2.06E-01 -1.20E+00
Skin cancer 2C30-2C3Z Skin 5.82E-07 -7.84E-02 -2.17E-01
Thrombocythemia 3B63 Whole blood 3.78E-01 -2.04E-01 -5.35E-01
Thrombocytopenia 3B64 Whole blood 5.91E-01 4.36E-01 3.80E-01
Thyroid cancer 2D10 Thyroid 1.31E-28 1.81E+00 2.05E+00
Tibial muscular dystrophy 8C75 Muscle tissue 2.16E-03 7.50E-01 1.77E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.44E-02 1.63E+00 3.42E+00
Type 2 diabetes 5A11 Liver tissue 1.22E-01 -3.31E-01 -1.38E+00
Ureter cancer 2C92 Urothelium 7.97E-01 2.67E-02 3.71E-02
Uterine cancer 2C78 Endometrium tissue 5.84E-03 -2.60E-01 -4.02E-01
Vitiligo ED63.0 Skin 8.70E-01 1.68E-02 6.64E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Cathepsin H (CTSH) DTT Info
DME DTT Type Literature-reported
1 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
PMID16290936C1b DMOP8YM Discovery agent N.A. Investigative [1]

References

1 Semicarbazone-based inhibitors of cathepsin K, are they prodrugs for aldehyde inhibitors Bioorg Med Chem Lett. 2006 Feb 15;16(4):978-83.
2 Human brain cathepsin H as a neuropeptide and bradykinin metabolizing enzyme. Peptides. 2003 Dec;24(12):1977-84.