Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEHKRDS)

DME Name Arylsulfatase B (ARSB)
Synonyms N-acetylgalactosamine-4-sulfatase; Arylsulfatase B component; ARSB; ASB; G4S
Gene Name ARSB
UniProt ID
ARSB_HUMAN
INTEDE ID
DME0105
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
411
EC Number EC: 3.1.6.12
Hydrolases
Ester bond hydrolase
Sulfuric ester hydrolase
EC: 3.1.6.12
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDV
GFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPS
CVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHER
CTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQS
VHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTD
NGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKL
ARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLP
EYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRD
PEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM
Function This enzyme removes sulfate groups from chondroitin-4-sulfate (C4S) and regulates its degradation.
KEGG Pathway
Glycosaminoglycan degradation (hsa00531 )
Lysosome (hsa04142 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Glycosphingolipid metabolism (R-HSA-1660662 )
MPS VI - Maroteaux-Lamy syndrome (R-HSA-2206285 )
Neutrophil degranulation (R-HSA-6798695 )
The activation of arylsulfatases (R-HSA-1663150 )
CS/DS degradation (R-HSA-2024101 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Chondroitin sulfate DM0N19Y N. A. N. A. Phase 4 [2]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.53E-01 3.87E-02 1.86E-01
Alopecia ED70 Skin from scalp 4.75E-01 -4.79E-02 -2.54E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.73E-03 -6.45E-02 -4.66E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.76E-01 1.27E-01 4.74E-01
Aortic stenosis BB70 Calcified aortic valve 3.43E-01 1.46E-01 4.56E-01
Apnea 7A40 Hyperplastic tonsil 4.43E-01 -6.14E-02 -5.09E-01
Arthropathy FA00-FA5Z Peripheral blood 1.53E-01 5.96E-02 2.75E-01
Asthma CA23 Nasal and bronchial airway 7.04E-01 -3.73E-02 -1.49E-01
Atopic dermatitis EA80 Skin 7.40E-02 1.12E-01 6.33E-01
Autism 6A02 Whole blood 1.27E-01 -1.35E-02 -5.55E-02
Autoimmune uveitis 9A96 Peripheral monocyte 6.69E-01 -1.20E-01 -4.08E-01
Autosomal dominant monocytopenia 4B04 Whole blood 4.85E-01 1.00E-01 2.65E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.07E-10 2.09E-01 1.04E+00
Batten disease 5C56.1 Whole blood 9.64E-01 1.41E-02 9.86E-02
Behcet's disease 4A62 Peripheral blood 4.90E-01 4.12E-02 1.69E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.75E-01 -5.18E-02 -4.37E-01
Bladder cancer 2C94 Bladder tissue 1.24E-01 8.54E-02 4.59E-01
Breast cancer 2C60-2C6Z Breast tissue 1.36E-31 2.49E-01 8.98E-01
Cardioembolic stroke 8B11.20 Whole blood 3.11E-06 3.96E-01 1.39E+00
Cervical cancer 2C77 Cervical tissue 6.04E-01 -1.18E-02 -6.69E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.83E-01 5.92E-02 1.97E-01
Chronic hepatitis C 1E51.1 Whole blood 2.12E-01 9.81E-02 7.47E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.24E-01 -1.32E-02 -7.51E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.69E-01 4.71E-03 3.53E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.80E-02 6.03E-02 7.33E-01
Colon cancer 2B90 Colon tissue 9.58E-01 -1.69E-02 -6.37E-02
Coronary artery disease BA80-BA8Z Peripheral blood 6.70E-01 -2.08E-02 -2.24E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.01E-01 -6.93E-02 -1.00E+00
Endometriosis GA10 Endometrium tissue 4.56E-01 8.59E-02 2.03E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.52E-02 -1.06E-01 -1.15E+00
Familial hypercholesterolemia 5C80.00 Whole blood 5.57E-03 3.56E-01 1.33E+00
Gastric cancer 2B72 Gastric tissue 4.71E-02 1.70E-01 1.46E+00
Glioblastopma 2A00.00 Nervous tissue 1.91E-91 3.27E-01 1.46E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.61E-05 -3.74E-01 -1.02E+01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.46E-02 2.58E-01 7.01E-01
Head and neck cancer 2D42 Head and neck tissue 1.75E-38 3.68E-01 2.33E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.74E-01 -3.61E-02 -2.70E-01
Huntington's disease 8A01.10 Whole blood 1.24E-01 -5.59E-02 -5.97E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.10E-01 -2.70E-03 -1.76E-02
Immunodeficiency 4A00-4A20 Peripheral blood 2.00E-01 1.83E-01 1.44E+00
Influenza 1E30 Whole blood 4.19E-02 -5.83E-01 -1.22E+00
Interstitial cystitis GC00.3 Bladder tissue 8.00E-05 3.78E-01 3.91E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.02E-05 9.04E-01 3.96E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.43E-01 -2.82E-02 -1.09E-01
Ischemic stroke 8B11 Peripheral blood 7.21E-02 -1.45E-01 -5.85E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 8.75E-01 7.25E-02 2.33E-01
Lateral sclerosis 8B60.4 Skin 8.79E-01 -2.30E-04 -7.77E-04
Lateral sclerosis 8B60.4 Cervical spinal cord 2.82E-01 8.29E-02 4.41E-01
Liver cancer 2C12.0 Liver tissue 9.73E-03 1.54E-01 4.70E-01
Liver failure DB99.7-DB99.8 Liver tissue 6.11E-02 2.84E-01 1.00E+00
Lung cancer 2C25 Lung tissue 7.11E-09 1.25E-01 4.61E-01
Lupus erythematosus 4A40 Whole blood 1.78E-01 -2.48E-02 -6.55E-02
Major depressive disorder 6A70-6A7Z Hippocampus 7.41E-02 8.71E-02 8.05E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.49E-01 1.16E-02 4.33E-02
Melanoma 2C30 Skin 5.13E-02 8.11E-01 8.20E-01
Multiple myeloma 2A83.1 Peripheral blood 7.62E-01 -4.15E-02 -1.24E-01
Multiple myeloma 2A83.1 Bone marrow 2.07E-04 4.91E-01 2.18E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.51E-01 -2.54E-01 -6.69E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.59E-01 -1.52E-02 -6.10E-02
Myelofibrosis 2A20.2 Whole blood 6.38E-04 -4.45E-01 -2.15E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.04E-02 2.36E-01 6.01E-01
Myopathy 8C70.6 Muscle tissue 4.28E-02 1.21E-01 8.13E-01
Neonatal sepsis KA60 Whole blood 2.54E-02 1.32E-02 5.65E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.20E-02 1.35E-01 7.19E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 4.84E-01 4.04E-02 3.51E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.65E-02 1.55E-01 1.09E+00
Olive pollen allergy CA08.00 Peripheral blood 4.64E-01 5.95E-02 2.09E-01
Oral cancer 2B6E Oral tissue 1.53E-16 4.25E-01 2.61E+00
Osteoarthritis FA00-FA0Z Synovial tissue 5.22E-01 6.73E-01 5.31E-01
Osteoporosis FB83.1 Bone marrow 1.80E-01 -4.36E-01 -8.45E-01
Ovarian cancer 2C73 Ovarian tissue 2.22E-04 2.98E-01 1.57E+00
Pancreatic cancer 2C10 Pancreas 4.04E-01 6.20E-02 2.43E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 7.50E-01 4.63E-02 3.29E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.36E-02 9.89E-02 3.92E-01
Pituitary cancer 2D12 Pituitary tissue 1.12E-02 2.00E-01 8.95E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.89E-01 8.14E-02 4.44E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.34E-01 -3.22E-03 -3.66E-02
Polycythemia vera 2A20.4 Whole blood 1.86E-01 -2.56E-02 -1.17E-01
Pompe disease 5C51.3 Biceps muscle 1.50E-01 7.52E-02 6.90E-01
Preterm birth KA21.4Z Myometrium 5.50E-01 -9.27E-02 -3.32E-01
Prostate cancer 2C82 Prostate 1.07E-02 2.27E-01 6.27E-01
Psoriasis EA90 Skin 8.36E-03 -7.88E-02 -3.98E-01
Rectal cancer 2B92 Rectal colon tissue 9.13E-02 -2.80E-01 -9.02E-01
Renal cancer 2C90-2C91 Kidney 3.97E-03 4.78E-01 1.54E+00
Retinoblastoma 2D02.2 Uvea 2.05E-01 1.82E-01 2.08E+00
Rheumatoid arthritis FA20 Synovial tissue 1.07E-04 9.07E-01 3.01E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.99E-01 -3.21E-02 -3.05E-01
Schizophrenia 6A20 Prefrontal cortex 2.27E-01 1.53E-02 4.64E-02
Schizophrenia 6A20 Superior temporal cortex 6.32E-01 -1.39E-03 -2.46E-02
Scleroderma 4A42.Z Whole blood 2.21E-03 2.27E-01 1.29E+00
Seizure 8A60-8A6Z Whole blood 8.14E-01 1.33E-02 3.80E-02
Sensitive skin EK0Z Skin 9.71E-01 -6.13E-02 -3.80E-01
Sepsis with septic shock 1G41 Whole blood 2.22E-08 1.66E-01 5.77E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.96E-01 3.61E-01 8.39E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.39E-04 2.63E-01 2.96E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 9.56E-01 6.93E-02 1.33E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.80E-01 2.81E-02 9.67E-01
Skin cancer 2C30-2C3Z Skin 1.81E-70 7.55E-01 3.03E+00
Thrombocythemia 3B63 Whole blood 5.02E-01 -5.07E-02 -2.46E-01
Thrombocytopenia 3B64 Whole blood 7.51E-01 1.85E-01 6.31E-01
Thyroid cancer 2D10 Thyroid 1.96E-19 3.71E-01 1.48E+00
Tibial muscular dystrophy 8C75 Muscle tissue 9.64E-05 3.55E-01 1.80E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 6.64E-02 2.37E-01 2.13E+00
Type 2 diabetes 5A11 Liver tissue 4.98E-01 8.76E-02 5.56E-01
Ureter cancer 2C92 Urothelium 8.46E-02 -3.04E-02 -3.30E-01
Uterine cancer 2C78 Endometrium tissue 5.69E-06 -1.92E-01 -3.68E-01
Vitiligo ED63.0 Skin 1.53E-01 -1.02E-01 -4.40E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name N-acetylgalactosamine-4-sulfatase (G4S) DTT Info
DME DTT Type Successful
1 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Galsulfase DMER9YA Mucopolysaccharidosis 5C56.3 Approved [1]

References

1 Enzyme replacement therapy for mucopolysaccharidosis VI: long-term cardiac effects of galsulfase (Naglazyme ) therapy. J Inherit Metab Dis. 2013 Mar;36(2):385-94.
2 MFN human ref: Chondroitin sulfate degradation.