Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEHKSC6)

DME Name Prostaglandin dehydrogenase 1 (HPGD)
Synonyms Dehydrogenase/reductase family 36C member 1; Short chain dehydrogenase/reductase family 36C member 1; 15-PGDH; 15-hydroxyprostaglandin dehydrogenase [NAD(+)]; HPGD; PGDH1; SDR36C1
Gene Name HPGD
UniProt ID
PGDH_HUMAN
INTEDE ID
DME0566
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
3248
EC Number EC: 1.1.1.141
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.141
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLF
IQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLD
YMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNA
ICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNG
AIMKITTSKGIHFQDYDTTPFQAKTQ
Function This enzyme catalyzes the NAD-dependent dehydrogenation of lipoxin A4 to form 15-oxo-lipoxin A4.
KEGG Pathway
Transcriptional misregulation in cancer (hsa05202 )
Reactome Pathway
Biosynthesis of E-series 18(S)-resolvins (R-HSA-9018896 )
Synthesis of Lipoxins (LX) (R-HSA-2142700 )
Synthesis of Prostaglandins (PG) and Thromboxanes (TX) (R-HSA-2162123 )
Biosynthesis of D-series resolvins (R-HSA-9018676 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Alprostadil DMWH7NQ Aorta coarctation Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 8.66E-06 -9.35E-02 -2.14E-01
Alopecia ED70 Skin from scalp 1.94E-03 3.52E-01 7.82E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.09E-01 2.66E-02 8.66E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 7.98E-01 -1.50E-01 -2.00E-01
Aortic stenosis BB70 Calcified aortic valve 6.30E-01 -1.07E-01 -2.62E-01
Apnea 7A40 Hyperplastic tonsil 4.79E-01 1.46E-01 1.06E-01
Arthropathy FA00-FA5Z Peripheral blood 7.09E-01 -1.92E-01 -3.77E-01
Asthma CA23 Nasal and bronchial airway 7.72E-08 1.42E+00 7.70E-01
Atopic dermatitis EA80 Skin 8.29E-14 -1.69E+00 -5.19E+00
Autism 6A02 Whole blood 2.62E-01 4.72E-02 8.71E-02
Autoimmune uveitis 9A96 Peripheral monocyte 1.08E-01 -2.14E-01 -1.01E+00
Autosomal dominant monocytopenia 4B04 Whole blood 8.36E-02 1.07E+00 2.13E+00
Bacterial infection of gingival 1C1H Gingival tissue 2.53E-14 -1.10E+00 -1.30E+00
Batten disease 5C56.1 Whole blood 9.93E-01 3.27E-01 9.21E-01
Behcet's disease 4A62 Peripheral blood 3.60E-01 -4.59E-01 -9.28E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.03E-01 -6.77E-03 -4.26E-02
Bladder cancer 2C94 Bladder tissue 6.14E-10 -2.99E+00 -5.29E+00
Breast cancer 2C60-2C6Z Breast tissue 4.67E-06 -5.10E-01 -3.13E-01
Cardioembolic stroke 8B11.20 Whole blood 3.61E-02 2.36E-01 5.11E-01
Cervical cancer 2C77 Cervical tissue 1.89E-04 -1.50E+00 -1.08E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.03E-01 -4.69E-02 -6.32E-02
Chronic hepatitis C 1E51.1 Whole blood 1.85E-01 -2.53E-01 -5.43E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.80E-02 -3.48E-01 -4.66E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.39E-03 -3.14E-01 -2.86E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.17E-03 -1.82E+00 -1.65E+00
Colon cancer 2B90 Colon tissue 4.43E-139 -3.54E+00 -4.61E+00
Coronary artery disease BA80-BA8Z Peripheral blood 4.61E-01 1.88E-01 4.62E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.36E-01 -4.37E-02 -2.70E-01
Endometriosis GA10 Endometrium tissue 8.89E-04 -1.60E+00 -7.87E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.77E-01 2.92E-01 5.45E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.20E-01 1.16E-01 3.74E-01
Gastric cancer 2B72 Gastric tissue 1.84E-01 -1.45E+00 -1.03E+00
Glioblastopma 2A00.00 Nervous tissue 2.31E-01 -3.52E-02 -9.45E-02
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 8.83E-01 -5.91E-02 -5.45E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.61E-02 -4.31E-01 -5.01E-01
Head and neck cancer 2D42 Head and neck tissue 4.28E-21 -1.96E+00 -1.78E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.39E-01 -2.85E-02 -2.29E-01
Huntington's disease 8A01.10 Whole blood 9.72E-01 -1.22E-02 -7.26E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.87E-01 4.15E-01 5.62E-01
Immunodeficiency 4A00-4A20 Peripheral blood 9.48E-01 2.33E-01 6.51E-01
Influenza 1E30 Whole blood 4.20E-02 4.18E-01 1.94E+00
Interstitial cystitis GC00.3 Bladder tissue 2.89E-02 -6.27E-01 -1.51E+00
Intracranial aneurysm 8B01.0 Intracranial artery 7.69E-02 6.68E-01 1.20E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.20E-01 -1.46E-02 -4.33E-02
Ischemic stroke 8B11 Peripheral blood 1.88E-01 -3.24E-01 -5.84E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.95E-05 1.10E-01 2.60E-01
Lateral sclerosis 8B60.4 Skin 4.30E-01 4.32E-02 5.19E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 9.90E-02 8.57E-02 8.47E-01
Liver cancer 2C12.0 Liver tissue 7.83E-24 -2.54E+00 -2.56E+00
Liver failure DB99.7-DB99.8 Liver tissue 4.59E-05 -3.51E+00 -3.03E+00
Lung cancer 2C25 Lung tissue 1.17E-103 -2.47E+00 -2.71E+00
Lupus erythematosus 4A40 Whole blood 4.53E-04 3.13E-01 4.16E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.01E-01 -1.84E-02 -1.21E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.78E-01 -1.92E-02 -2.55E-02
Melanoma 2C30 Skin 9.39E-01 1.40E-01 8.56E-02
Multiple myeloma 2A83.1 Peripheral blood 4.74E-01 1.99E-01 1.52E-01
Multiple myeloma 2A83.1 Bone marrow 1.14E-02 -2.85E-01 -1.38E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.92E-01 -1.92E-01 -6.81E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.43E-01 -8.21E-02 -1.23E-01
Myelofibrosis 2A20.2 Whole blood 1.49E-03 -3.52E-01 -1.12E+00
Myocardial infarction BA41-BA50 Peripheral blood 5.88E-01 -4.47E-01 -5.20E-01
Myopathy 8C70.6 Muscle tissue 9.67E-01 -9.69E-02 -1.42E-01
Neonatal sepsis KA60 Whole blood 1.12E-20 1.48E+00 1.93E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.39E-04 3.73E-02 3.57E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 1.05E-02 1.09E+00 1.61E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.49E-01 -1.81E-01 -2.83E-01
Olive pollen allergy CA08.00 Peripheral blood 3.42E-01 6.27E-02 3.68E-01
Oral cancer 2B6E Oral tissue 1.82E-02 -9.32E-01 -7.36E-01
Osteoarthritis FA00-FA0Z Synovial tissue 7.52E-01 -2.82E-01 -3.45E-01
Osteoporosis FB83.1 Bone marrow 1.80E-01 1.05E-01 9.63E-01
Ovarian cancer 2C73 Ovarian tissue 2.14E-01 7.15E-02 6.74E-02
Pancreatic cancer 2C10 Pancreas 2.03E-04 1.73E+00 1.47E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 2.29E-02 -2.84E-01 -5.71E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.36E-02 1.18E-01 2.29E-01
Pituitary cancer 2D12 Pituitary tissue 2.15E-01 1.39E-01 1.76E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.36E-01 6.57E-01 7.81E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.81E-01 5.63E-02 3.77E-01
Polycythemia vera 2A20.4 Whole blood 3.29E-09 5.23E-01 1.76E+00
Pompe disease 5C51.3 Biceps muscle 2.88E-02 7.40E-01 2.05E+00
Preterm birth KA21.4Z Myometrium 2.53E-01 2.31E-01 2.16E-01
Prostate cancer 2C82 Prostate 9.59E-01 1.63E-01 1.59E-01
Psoriasis EA90 Skin 2.04E-02 -1.23E-01 -2.08E-01
Rectal cancer 2B92 Rectal colon tissue 7.47E-09 -2.54E+00 -6.82E+00
Renal cancer 2C90-2C91 Kidney 3.40E-04 -2.23E+00 -2.40E+00
Retinoblastoma 2D02.2 Uvea 8.86E-02 1.81E-01 6.16E-01
Rheumatoid arthritis FA20 Synovial tissue 8.34E-02 -6.03E-01 -1.33E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.33E-01 6.21E-02 1.05E-01
Schizophrenia 6A20 Prefrontal cortex 8.74E-02 -1.01E-02 -1.04E-02
Schizophrenia 6A20 Superior temporal cortex 9.18E-01 1.76E-02 1.41E-01
Scleroderma 4A42.Z Whole blood 6.50E-01 2.90E-02 6.21E-02
Seizure 8A60-8A6Z Whole blood 6.20E-02 4.95E-01 6.65E-01
Sensitive skin EK0Z Skin 9.85E-01 -5.16E-02 -1.66E-01
Sepsis with septic shock 1G41 Whole blood 3.14E-75 1.92E+00 2.75E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.38E-01 3.64E-01 1.07E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.58E-01 6.29E-01 9.27E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.94E-01 1.03E-02 2.50E-03
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.20E-02 1.93E-01 8.37E-01
Skin cancer 2C30-2C3Z Skin 1.30E-30 -1.23E+00 -1.93E+00
Thrombocythemia 3B63 Whole blood 3.60E-03 1.08E-01 3.79E-01
Thrombocytopenia 3B64 Whole blood 4.58E-01 -1.86E-01 -2.41E-01
Thyroid cancer 2D10 Thyroid 5.96E-02 -9.55E-02 -1.61E-01
Tibial muscular dystrophy 8C75 Muscle tissue 9.53E-03 6.94E-01 1.02E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.72E-01 2.51E-01 1.10E+00
Type 2 diabetes 5A11 Liver tissue 2.76E-01 1.98E-01 8.48E-01
Ureter cancer 2C92 Urothelium 4.63E-01 -1.08E+00 -5.36E-01
Uterine cancer 2C78 Endometrium tissue 1.23E-05 -1.10E+00 -6.67E-01
Vitiligo ED63.0 Skin 4.08E-01 -9.24E-02 -4.77E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Effect of calcium ionophore A23187 on prostaglandin synthase type 2 and 15-hydroxy-prostaglandin dehydrogenase expression in human chorion trophoblast cells. Am J Obstet Gynecol. 2008 Nov;199(5):554.e1-8.