Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEHX1DZ)

DME Name Lactoperoxidase (LPO)
Synonyms Salivary peroxidase; Anionic isoperoxidase; Anionic peroxidase A1; LPO; SAPX; SPO
Gene Name LPO
UniProt ID
PERL_HUMAN
INTEDE ID
DME0246
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
4025
EC Number EC: 1.11.1.7
Oxidoreductase
Peroxidase
Peroxidase
EC: 1.11.1.7
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MRVLLHLPALLASLILLQAAASTTRAQTTRTSAISDTVSQAKVQVNKAFLDSRTRLKTAM
SSETPTSRQLSEYLKHAKGRTRTAIRNGQVWEESLKRLRQKASLTNVTDPSLDLTSLSLE
VGCGAPAPVVRCDPCSPYRTITGDCNNRRKPALGAANRALARWLPAEYEDGLSLPFGWTP
GKTRNGFPLPLAREVSNKIVGYLNEEGVLDQNRSLLFMQWGQIVDHDLDFAPDTELGSSE
YSKAQCDEYCIQGDNCFPIMFPPNDPKAGTQGKCMPFFRAGFVCPTPPYKSLAREQINAL
TSFLDASFVYSSEPSLASRLRNLSSPLGLMAVNQEVSDHGLPYLPYDSKKPSPCEFINTT
ARVPCFLAGDSRASEHILLATSHTLFLREHNRLARELKRLNPQWDGEKLYQEARKILGAF
VQIITFRDYLPILLGDHMQKWIPPYQGYSESVDPRISNVFTFAFRFGHLEVPSSMFRLDE
NYQPWGPEPELPLHTLFFNTWRMVKDGGIDPLVRGLLAKKSKLMKQNKMMTGELRNKLFQ
PTHRIHGFDLAAINTQRCRDHGQPGYNSWRAFCDLSQPQTLEELNTVLKSKMLAKKLLGL
YGTPDNIDIWIGAIAEPLVERGRVGPLLACLLGKQFQQIRDGDRFWWENPGVFTNEQKDS
LQKMSFSRLVCDNTRITKVPRDPFWANSYPYDFVDCSAIDKLDLSPWASVKN
Function
This enzyme catalyzes the oxidation of a number of inorganic and organic substrates by hydrogen peroxide. These substrates include bromide and iodide and therefore lactoperoxidase can be categorised as a haloperoxidase. Another important substrate is thiocyanate.
KEGG Pathway
Salivary secretion (hsa04970 )
Reactome Pathway
Events associated with phagocytolytic activity of PMN cells (R-HSA-8941413 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Estradiol DMUNTE3 Acne vulgaris ED80 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.64E-05 -1.92E-01 -6.35E-01
Alopecia ED70 Skin from scalp 6.63E-02 5.90E-02 2.16E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.37E-02 -8.27E-02 -4.45E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.30E-01 6.46E-02 4.38E-01
Aortic stenosis BB70 Calcified aortic valve 3.00E-01 1.30E-01 5.37E-01
Apnea 7A40 Hyperplastic tonsil 8.31E-01 6.45E-02 2.92E-01
Arthropathy FA00-FA5Z Peripheral blood 4.59E-01 6.32E-02 3.28E-01
Asthma CA23 Nasal and bronchial airway 3.35E-01 -1.10E-01 -2.94E-01
Atopic dermatitis EA80 Skin 6.28E-01 -4.84E-04 -3.34E-03
Autism 6A02 Whole blood 9.12E-01 -1.29E-02 -6.00E-02
Autoimmune uveitis 9A96 Peripheral monocyte 2.37E-01 -1.34E-01 -6.81E-01
Autosomal dominant monocytopenia 4B04 Whole blood 3.28E-01 -2.50E-02 -9.71E-02
Bacterial infection of gingival 1C1H Gingival tissue 1.85E-03 1.64E-01 5.77E-01
Batten disease 5C56.1 Whole blood 8.86E-01 3.97E-02 3.77E-01
Behcet's disease 4A62 Peripheral blood 3.20E-01 -7.24E-03 -3.35E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.18E-01 3.39E-02 1.40E-01
Bladder cancer 2C94 Bladder tissue 5.96E-05 5.83E-01 3.17E+00
Breast cancer 2C60-2C6Z Breast tissue 5.75E-02 -1.14E-02 -2.96E-02
Cardioembolic stroke 8B11.20 Whole blood 9.58E-01 -8.11E-02 -3.51E-01
Cervical cancer 2C77 Cervical tissue 8.57E-01 7.79E-02 2.98E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.61E-01 1.26E-01 3.87E-01
Chronic hepatitis C 1E51.1 Whole blood 7.20E-01 1.65E-02 8.13E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 2.26E-02 5.51E-02 2.49E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.47E-01 2.22E-02 1.05E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.93E-02 1.01E+00 5.83E+00
Colon cancer 2B90 Colon tissue 2.87E-15 -2.52E-01 -8.17E-01
Coronary artery disease BA80-BA8Z Peripheral blood 6.15E-02 -2.84E-01 -1.48E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.64E-01 5.20E-02 3.59E-01
Endometriosis GA10 Endometrium tissue 3.83E-01 5.97E-02 2.42E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.76E-01 6.73E-02 2.82E-01
Familial hypercholesterolemia 5C80.00 Whole blood 6.34E-02 -8.80E-02 -2.31E-01
Gastric cancer 2B72 Gastric tissue 7.23E-01 -1.66E-01 -9.27E-01
Glioblastopma 2A00.00 Nervous tissue 1.89E-18 -2.38E-01 -6.98E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.69E-01 2.34E-01 1.50E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.15E-06 -7.53E-01 -2.85E+00
Head and neck cancer 2D42 Head and neck tissue 5.39E-03 -1.25E-01 -9.64E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.09E-01 -5.69E-02 -1.69E-01
Huntington's disease 8A01.10 Whole blood 6.18E-01 5.62E-02 3.84E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.07E-01 2.49E-02 1.65E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.20E-01 9.34E-02 8.99E-01
Influenza 1E30 Whole blood 6.99E-01 -5.21E-02 -2.78E-01
Interstitial cystitis GC00.3 Bladder tissue 6.57E-01 -1.30E-02 -9.92E-02
Intracranial aneurysm 8B01.0 Intracranial artery 5.44E-02 8.17E-02 4.24E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.92E-01 -3.09E-03 -1.22E-02
Ischemic stroke 8B11 Peripheral blood 8.83E-01 7.23E-04 3.49E-03
Juvenile idiopathic arthritis FA24 Peripheral blood 7.86E-03 8.50E-02 2.41E-01
Lateral sclerosis 8B60.4 Skin 3.72E-01 4.83E-02 4.88E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 7.27E-01 1.38E-01 4.18E-01
Liver cancer 2C12.0 Liver tissue 3.50E-07 -3.49E-01 -9.96E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.40E-01 -8.07E-02 -3.07E-01
Lung cancer 2C25 Lung tissue 7.04E-01 -1.90E-03 -5.82E-03
Lupus erythematosus 4A40 Whole blood 6.72E-01 3.82E-02 8.03E-02
Major depressive disorder 6A70-6A7Z Hippocampus 2.82E-01 5.36E-02 2.28E-01
Major depressive disorder 6A70-6A7Z Whole blood 5.68E-01 -5.95E-02 -2.20E-01
Melanoma 2C30 Skin 1.06E-01 -1.46E-01 -2.46E-01
Multiple myeloma 2A83.1 Peripheral blood 8.53E-01 -3.03E-02 -8.29E-02
Multiple myeloma 2A83.1 Bone marrow 5.40E-03 -6.24E-01 -1.68E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.75E-02 2.95E-01 1.03E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.56E-01 -4.02E-02 -1.42E-01
Myelofibrosis 2A20.2 Whole blood 5.33E-05 3.23E-01 1.60E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.27E-02 2.42E-01 4.76E-01
Myopathy 8C70.6 Muscle tissue 2.07E-01 -5.50E-02 -1.90E-01
Neonatal sepsis KA60 Whole blood 4.88E-01 4.03E-02 1.03E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.08E-04 -7.56E-01 -1.72E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 8.40E-01 -7.83E-02 -6.38E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.38E-01 -9.07E-03 -8.68E-02
Olive pollen allergy CA08.00 Peripheral blood 1.52E-02 1.47E-01 1.32E+00
Oral cancer 2B6E Oral tissue 3.22E-03 -4.81E-01 -2.41E-01
Osteoarthritis FA00-FA0Z Synovial tissue 9.46E-01 1.93E-01 5.34E-01
Osteoporosis FB83.1 Bone marrow 1.68E-01 2.79E-01 2.98E+00
Ovarian cancer 2C73 Ovarian tissue 1.57E-02 2.84E-01 1.02E+00
Pancreatic cancer 2C10 Pancreas 5.44E-02 -1.93E-01 -4.27E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 3.07E-02 -3.73E-01 -6.02E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.15E-02 5.42E-02 4.22E-01
Pituitary cancer 2D12 Pituitary tissue 1.76E-02 2.47E-01 8.80E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.45E-02 2.56E-02 1.38E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.40E-01 2.44E-02 1.63E-01
Polycythemia vera 2A20.4 Whole blood 3.37E-11 2.95E-01 1.37E+00
Pompe disease 5C51.3 Biceps muscle 3.47E-01 -4.41E-03 -3.86E-02
Preterm birth KA21.4Z Myometrium 7.82E-01 4.03E-02 2.15E-01
Prostate cancer 2C82 Prostate 3.19E-01 -9.13E-02 -2.49E-01
Psoriasis EA90 Skin 3.46E-01 -1.54E-02 -4.36E-02
Rectal cancer 2B92 Rectal colon tissue 7.30E-01 5.25E-02 2.31E-01
Renal cancer 2C90-2C91 Kidney 8.80E-02 -4.18E-01 -9.95E-01
Retinoblastoma 2D02.2 Uvea 1.15E-06 -9.59E-01 -4.90E+00
Rheumatoid arthritis FA20 Synovial tissue 5.23E-01 3.34E-01 7.44E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.86E-01 4.79E-02 2.69E-01
Schizophrenia 6A20 Prefrontal cortex 6.67E-01 3.24E-03 1.15E-02
Schizophrenia 6A20 Superior temporal cortex 2.49E-01 -2.83E-03 -2.08E-02
Scleroderma 4A42.Z Whole blood 1.99E-01 -1.43E-01 -7.96E-01
Seizure 8A60-8A6Z Whole blood 6.34E-01 5.03E-02 1.96E-01
Sensitive skin EK0Z Skin 4.86E-01 -3.05E-03 -4.56E-02
Sepsis with septic shock 1G41 Whole blood 4.04E-02 1.22E-01 2.94E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.83E-02 2.86E-01 6.61E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.07E-02 2.50E-01 9.19E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.18E-01 2.76E-02 5.06E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.12E-01 8.15E-02 1.84E-01
Skin cancer 2C30-2C3Z Skin 1.89E-01 -3.16E-02 -8.05E-02
Thrombocythemia 3B63 Whole blood 6.11E-04 2.34E-01 1.26E+00
Thrombocytopenia 3B64 Whole blood 6.54E-01 -3.98E-03 -2.43E-02
Thyroid cancer 2D10 Thyroid 1.13E-02 5.53E-02 2.24E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.29E-03 -2.29E-01 -1.18E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.07E-01 4.77E-02 5.56E-01
Type 2 diabetes 5A11 Liver tissue 4.04E-01 -3.05E-02 -1.93E-01
Ureter cancer 2C92 Urothelium 9.91E-01 1.48E-02 1.07E-01
Uterine cancer 2C78 Endometrium tissue 7.02E-03 5.74E-02 1.59E-01
Vitiligo ED63.0 Skin 2.93E-01 -8.46E-02 -6.38E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 The metabolism of 17 beta-estradiol by lactoperoxidase: a possible source of oxidative stress in breast cancer. Carcinogenesis. 1994 Nov;15(11):2637-43.