Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEIOH6A)

DME Name Alcohol dehydrogenase class-III (ADH5)
Synonyms
Alcohol dehydrogenase 5; Alcohol dehydrogenase class chi chain; Alcohol dehydrogenase class-3; Glutathione-dependent formaldehyde dehydrogenase; S-(hydroxymethyl)glutathione dehydrogenase; ADH5; ADHX; FALDH; FDH; GSH-FDH
Gene Name ADH5
UniProt ID
ADHX_HUMAN
INTEDE ID
DME0132
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
128
EC Number EC: 1.1.1.1
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MANEVIKCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGC
FPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGK
GLMPDGTSRFTCKGKTILHYMGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGY
GAAVNTAKLEPGSVCAVFGLGGVGLAVIMGCKVAGASRIIGVDINKDKFARAKEFGATEC
INPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEE
IATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFE
LMHSGKSIRTVVKI
Function
This enzyme catalyzes the oxidation of long-chain primary alcohols and the oxidation of S-(hydroxymethyl) glutathione, and oxidizes long chain omega-hydroxy fatty acids, such as 20-HETE, producing both the intermediate aldehyde, 20-oxoarachidonate and the end product, a dicarboxylic acid, (5Z,8Z,11Z,14Z)-eicosatetraenedioate.
KEGG Pathway
Carbon metabolism (hsa01200 )
Chemical carcinogenesis (hsa05204 )
Drug metabolism - cytochrome P450 (hsa00982 )
Fatty acid degradation (hsa00071 )
Glycolysis / Gluconeogenesis (hsa00010 )
Metabolic pathways (hsa01100 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Retinol metabolism (hsa00830 )
Tyrosine metabolism (hsa00350 )
Reactome Pathway
Ethanol oxidation (R-HSA-71384 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
3 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Ethanol DMDRQZU Chronic pain MG30 Approved [1]
NADH DM5NM6E Parkinson disease 8A00.0 Approved [2]
Polyethylene glycol DM4I1JP Constipation DD91.1 Approved [3]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.20E-04 1.08E-01 2.65E-01
Alopecia ED70 Skin from scalp 3.23E-04 1.19E-01 6.50E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.60E-01 5.34E-02 2.06E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.59E-01 2.26E-01 7.43E-01
Aortic stenosis BB70 Calcified aortic valve 5.04E-01 -4.63E-01 -3.28E-01
Apnea 7A40 Hyperplastic tonsil 9.98E-01 1.25E-01 2.29E-01
Arthropathy FA00-FA5Z Peripheral blood 1.12E-01 -8.87E-02 -2.97E-01
Asthma CA23 Nasal and bronchial airway 1.46E-01 1.33E-01 1.98E-01
Atopic dermatitis EA80 Skin 3.00E-07 -3.23E-01 -1.81E+00
Autism 6A02 Whole blood 9.01E-01 9.19E-02 1.67E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.08E-01 1.35E-01 2.49E-01
Autosomal dominant monocytopenia 4B04 Whole blood 3.94E-01 1.40E-01 2.69E-01
Bacterial infection of gingival 1C1H Gingival tissue 8.53E-01 5.98E-02 1.84E-01
Batten disease 5C56.1 Whole blood 1.47E-01 -1.68E-01 -8.42E-01
Behcet's disease 4A62 Peripheral blood 9.66E-01 -6.03E-02 -3.60E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.36E-01 3.08E-02 2.42E-01
Bladder cancer 2C94 Bladder tissue 2.29E-07 -1.22E+00 -4.37E+00
Breast cancer 2C60-2C6Z Breast tissue 2.60E-60 -9.08E-01 -1.46E+00
Cardioembolic stroke 8B11.20 Whole blood 5.91E-01 2.27E-02 9.58E-02
Cervical cancer 2C77 Cervical tissue 2.99E-02 2.29E-01 5.00E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.30E-01 -1.37E-01 -1.08E-01
Chronic hepatitis C 1E51.1 Whole blood 1.98E-01 -1.03E-01 -3.44E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.43E-01 3.89E-02 1.76E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.36E-02 -1.36E-01 -5.23E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.76E-02 -3.00E-01 -9.40E-01
Colon cancer 2B90 Colon tissue 1.99E-13 -1.99E-01 -5.78E-01
Coronary artery disease BA80-BA8Z Peripheral blood 1.76E-03 1.51E+00 3.78E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.12E-01 -6.48E-02 -1.69E-01
Endometriosis GA10 Endometrium tissue 1.28E-03 -3.87E-01 -1.31E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.99E-03 1.75E-01 1.51E+00
Familial hypercholesterolemia 5C80.00 Whole blood 2.26E-04 3.42E-01 8.83E-01
Gastric cancer 2B72 Gastric tissue 5.95E-01 2.39E-01 4.96E-01
Glioblastopma 2A00.00 Nervous tissue 1.82E-107 6.40E-01 1.59E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.40E-01 9.05E-01 1.72E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.51E-07 8.58E-01 2.46E+00
Head and neck cancer 2D42 Head and neck tissue 9.68E-08 2.28E-01 6.79E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.15E-01 -4.55E-02 -1.11E-01
Huntington's disease 8A01.10 Whole blood 6.05E-01 -1.67E-01 -3.01E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.47E-01 -3.93E-01 -9.09E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.54E-01 -1.36E-01 -1.38E+00
Influenza 1E30 Whole blood 1.35E-01 -8.43E-01 -1.73E+00
Interstitial cystitis GC00.3 Bladder tissue 4.36E-02 -2.43E-01 -1.32E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.47E-03 -7.92E-01 -2.57E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 7.76E-03 -1.43E-01 -4.92E-01
Ischemic stroke 8B11 Peripheral blood 3.65E-01 -1.63E-02 -6.80E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 6.24E-08 -1.25E-01 -4.09E-01
Lateral sclerosis 8B60.4 Skin 7.11E-01 -3.09E-02 -1.48E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 8.78E-02 -1.34E-01 -2.02E-01
Liver cancer 2C12.0 Liver tissue 3.43E-01 -1.04E-01 -2.38E-01
Liver failure DB99.7-DB99.8 Liver tissue 6.67E-05 -7.42E-01 -2.78E+00
Lung cancer 2C25 Lung tissue 1.44E-22 -3.15E-01 -8.81E-01
Lupus erythematosus 4A40 Whole blood 4.24E-01 -8.57E-02 -1.82E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.91E-01 -4.92E-02 -4.00E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.93E-02 -6.64E-02 -1.83E-01
Melanoma 2C30 Skin 3.65E-01 3.89E-01 4.53E-01
Multiple myeloma 2A83.1 Peripheral blood 9.59E-01 -3.61E-02 -1.50E-01
Multiple myeloma 2A83.1 Bone marrow 3.57E-05 6.21E-01 2.89E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.93E-01 4.65E-02 2.61E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.58E-01 7.62E-03 2.51E-02
Myelofibrosis 2A20.2 Whole blood 3.87E-02 -9.91E-02 -3.92E-01
Myocardial infarction BA41-BA50 Peripheral blood 2.02E-05 -4.42E-01 -8.98E-01
Myopathy 8C70.6 Muscle tissue 4.33E-01 3.64E-02 1.24E-01
Neonatal sepsis KA60 Whole blood 2.39E-08 -4.26E-01 -7.72E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.93E-05 1.21E+00 2.37E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 8.76E-01 3.98E-02 1.51E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.54E-01 -8.02E-02 -2.59E-01
Olive pollen allergy CA08.00 Peripheral blood 3.86E-01 2.85E-01 1.11E+00
Oral cancer 2B6E Oral tissue 4.11E-09 1.21E+00 1.99E+00
Osteoarthritis FA00-FA0Z Synovial tissue 3.68E-01 1.70E-01 2.43E-01
Osteoporosis FB83.1 Bone marrow 8.61E-03 -3.80E-01 -1.81E+00
Ovarian cancer 2C73 Ovarian tissue 2.40E-02 -5.33E-01 -1.20E+00
Pancreatic cancer 2C10 Pancreas 1.20E-04 4.71E-01 1.33E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 1.29E-01 -2.72E-01 -8.55E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.31E-02 -1.58E-01 -9.26E-01
Pituitary cancer 2D12 Pituitary tissue 6.69E-04 4.60E-01 1.18E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.21E-04 5.98E-01 1.65E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.05E-01 8.36E-02 5.56E-01
Polycythemia vera 2A20.4 Whole blood 8.53E-11 -3.26E-01 -1.34E+00
Pompe disease 5C51.3 Biceps muscle 5.82E-03 3.67E-01 1.63E+00
Preterm birth KA21.4Z Myometrium 1.45E-01 4.26E-01 5.32E-01
Prostate cancer 2C82 Prostate 4.11E-05 -7.87E-01 -1.35E+00
Psoriasis EA90 Skin 2.41E-13 -2.34E-01 -7.50E-01
Rectal cancer 2B92 Rectal colon tissue 1.25E-09 -6.16E-01 -5.80E+00
Renal cancer 2C90-2C91 Kidney 1.99E-01 -2.24E-02 -5.44E-02
Retinoblastoma 2D02.2 Uvea 3.62E-02 1.74E-01 6.31E-01
Rheumatoid arthritis FA20 Synovial tissue 2.21E-02 1.09E-01 2.47E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.98E-01 6.92E-02 3.46E-01
Schizophrenia 6A20 Prefrontal cortex 6.47E-01 1.99E-02 7.15E-02
Schizophrenia 6A20 Superior temporal cortex 3.04E-01 7.60E-02 4.60E-01
Scleroderma 4A42.Z Whole blood 4.93E-04 -2.87E-01 -1.54E+00
Seizure 8A60-8A6Z Whole blood 2.68E-01 5.87E-01 1.11E+00
Sensitive skin EK0Z Skin 6.51E-01 -1.33E-01 -6.07E-01
Sepsis with septic shock 1G41 Whole blood 5.06E-36 -8.40E-01 -1.58E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.63E-01 -4.25E-01 -8.76E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.16E-02 -3.55E-01 -7.62E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 3.21E-01 -1.10E-01 -4.86E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.59E-04 2.48E-01 3.68E+00
Skin cancer 2C30-2C3Z Skin 2.61E-05 -2.22E-01 -5.23E-01
Thrombocythemia 3B63 Whole blood 8.37E-05 -1.90E-01 -7.83E-01
Thrombocytopenia 3B64 Whole blood 1.14E-01 -2.79E-01 -1.42E+00
Thyroid cancer 2D10 Thyroid 1.27E-32 -5.28E-01 -1.95E+00
Tibial muscular dystrophy 8C75 Muscle tissue 8.89E-01 -2.14E-02 -5.69E-02
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.69E-01 -3.24E-02 -2.55E-01
Type 2 diabetes 5A11 Liver tissue 2.37E-01 2.35E-01 1.45E+00
Ureter cancer 2C92 Urothelium 3.95E-01 -7.35E-02 -3.07E-01
Uterine cancer 2C78 Endometrium tissue 2.15E-07 -4.23E-01 -6.64E-01
Vitiligo ED63.0 Skin 2.11E-01 -4.81E-02 -2.11E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Functional assessment of human alcohol dehydrogenase family in ethanol metabolism: significance of first-pass metabolism. Alcohol Clin Exp Res. 2006 Jul;30(7):1132-42.
2 Conformational changes and catalysis by alcohol dehydrogenase. Arch Biochem Biophys. 2010 Jan 1;493(1):3-12.
3 PEGylated proteins: evaluation of their safety in the absence of definitive metabolism studies. Drug Metab Dispos. 2007 Jan;35(1):9-16.