Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEJ6FSR)

DME Name Arylsulfatase A (ARSA)
Synonyms Arylsulfatase A component B; Arylsulfatase A component C; Cerebroside-sulfatase; ARSA; ASA
Gene Name ARSA
UniProt ID
ARSA_HUMAN
INTEDE ID
DME0193
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
410
EC Number EC: 3.1.6.8
Hydrolases
Ester bond hydrolase
Sulfuric ester hydrolase
EC: 3.1.6.8
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MGAPRSLLLALAAGLAVARPPNIVLIFADDLGYGDLGCYGHPSSTTPNLDQLAAGGLRFT
DFYVPVSLCTPSRAALLTGRLPVRMGMYPGVLVPSSRGGLPLEEVTVAEVLAARGYLTGM
AGKWHLGVGPEGAFLPPHQGFHRFLGIPYSHDQGPCQNLTCFPPATPCDGGCDQGLVPIP
LLANLSVEAQPPWLPGLEARYMAFAHDLMADAQRQDRPFFLYYASHHTHYPQFSGQSFAE
RSGRGPFGDSLMELDAAVGTLMTAIGDLGLLEETLVIFTADNGPETMRMSRGGCSGLLRC
GKGTTYEGGVREPALAFWPGHIAPGVTHELASSLDLLPTLAALAGAPLPNVTLDGFDLSP
LLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASSSL
TAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFGPSQVARG
EDPALQICCHPGCTPRPACCHCPDPHA
Function This enzyme hydrolyzes cerebroside sulfate.
KEGG Pathway
Lysosome (hsa04142 )
Sphingolipid metabolism (hsa00600 )
Reactome Pathway
Neutrophil degranulation (R-HSA-6798695 )
The activation of arylsulfatases (R-HSA-1663150 )
Glycosphingolipid metabolism (R-HSA-1660662 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Micafungin DM6Y3AN Aspergillosis 1F20 Approved [3]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.46E-02 1.46E-01 5.23E-01
Alopecia ED70 Skin from scalp 6.79E-01 -1.68E-01 -3.91E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.36E-01 4.15E-03 2.27E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 2.89E-01 1.72E-01 1.13E+00
Aortic stenosis BB70 Calcified aortic valve 8.44E-01 1.49E-02 7.98E-02
Apnea 7A40 Hyperplastic tonsil 3.81E-01 6.05E-02 2.61E-01
Arthropathy FA00-FA5Z Peripheral blood 3.02E-01 3.25E-02 1.14E-01
Asthma CA23 Nasal and bronchial airway 5.81E-03 9.40E-02 1.79E-01
Atopic dermatitis EA80 Skin 1.21E-10 3.66E-01 1.70E+00
Autism 6A02 Whole blood 8.64E-01 3.14E-02 1.60E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.64E-01 5.76E-02 2.62E-01
Autosomal dominant monocytopenia 4B04 Whole blood 4.23E-02 -3.54E-01 -1.02E+00
Bacterial infection of gingival 1C1H Gingival tissue 3.13E-15 3.87E-01 1.33E+00
Batten disease 5C56.1 Whole blood 9.48E-03 3.24E-01 1.28E+00
Behcet's disease 4A62 Peripheral blood 8.60E-01 1.40E-02 6.75E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.24E-01 -2.60E-02 -1.27E-01
Bladder cancer 2C94 Bladder tissue 1.12E-02 1.94E-01 1.08E+00
Breast cancer 2C60-2C6Z Breast tissue 9.54E-03 5.75E-02 1.77E-01
Cardioembolic stroke 8B11.20 Whole blood 2.31E-01 1.80E-01 6.59E-01
Cervical cancer 2C77 Cervical tissue 5.34E-01 -8.97E-02 -4.30E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.71E-01 -1.60E-01 -2.10E-01
Chronic hepatitis C 1E51.1 Whole blood 1.09E-01 -1.39E-01 -8.94E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 8.18E-01 -1.03E-02 -4.11E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.76E-02 1.10E-01 3.39E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.27E-01 1.37E-01 9.04E-01
Colon cancer 2B90 Colon tissue 8.32E-46 -4.63E-01 -1.65E+00
Coronary artery disease BA80-BA8Z Peripheral blood 7.60E-01 2.58E-02 1.50E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.22E-01 3.21E-02 1.06E-01
Endometriosis GA10 Endometrium tissue 1.26E-01 -6.36E-02 -1.85E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.34E-01 4.84E-02 3.22E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.03E-02 2.16E-01 1.20E+00
Gastric cancer 2B72 Gastric tissue 7.78E-01 -9.49E-02 -4.43E-01
Glioblastopma 2A00.00 Nervous tissue 1.89E-28 -2.47E-01 -8.91E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.56E-01 -3.17E-01 -6.59E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.91E-01 -1.62E-01 -7.47E-01
Head and neck cancer 2D42 Head and neck tissue 7.36E-01 -1.87E-02 -6.54E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.55E-01 2.68E-02 2.33E-01
Huntington's disease 8A01.10 Whole blood 4.50E-01 -2.02E-01 -1.10E+00
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.04E-03 2.55E-01 4.56E+00
Immunodeficiency 4A00-4A20 Peripheral blood 3.69E-01 1.02E-01 8.82E-01
Influenza 1E30 Whole blood 1.26E-02 2.04E-01 3.72E+00
Interstitial cystitis GC00.3 Bladder tissue 6.68E-01 -6.64E-03 -3.47E-02
Intracranial aneurysm 8B01.0 Intracranial artery 4.59E-03 8.03E-01 2.02E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.68E-01 6.70E-02 2.20E-01
Ischemic stroke 8B11 Peripheral blood 5.54E-01 2.97E-02 1.62E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 8.22E-01 -1.44E-01 -3.08E-01
Lateral sclerosis 8B60.4 Skin 8.43E-01 -1.35E-01 -4.15E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 3.34E-01 1.77E-01 7.57E-01
Liver cancer 2C12.0 Liver tissue 7.91E-01 -1.65E-01 -4.45E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.81E-03 3.80E-01 1.63E+00
Lung cancer 2C25 Lung tissue 8.19E-05 4.58E-02 1.88E-01
Lupus erythematosus 4A40 Whole blood 4.92E-12 1.94E-01 7.39E-01
Major depressive disorder 6A70-6A7Z Hippocampus 3.20E-01 4.62E-02 2.30E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.63E-01 3.77E-02 1.03E-01
Melanoma 2C30 Skin 3.05E-02 -2.53E-01 -5.41E-01
Multiple myeloma 2A83.1 Peripheral blood 4.50E-01 -6.75E-02 -3.30E-01
Multiple myeloma 2A83.1 Bone marrow 7.19E-01 -8.15E-02 -2.73E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.51E-01 6.97E-02 4.24E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.19E-02 -3.03E-02 -1.81E-01
Myelofibrosis 2A20.2 Whole blood 2.83E-01 -2.83E-02 -2.26E-01
Myocardial infarction BA41-BA50 Peripheral blood 8.46E-01 -1.65E-02 -3.67E-02
Myopathy 8C70.6 Muscle tissue 7.26E-01 -1.02E-02 -4.96E-02
Neonatal sepsis KA60 Whole blood 2.06E-03 9.29E-02 2.63E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.10E-04 -5.87E-01 -1.70E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.42E-01 -6.17E-02 -1.85E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.30E-02 2.39E-01 1.66E+00
Olive pollen allergy CA08.00 Peripheral blood 5.38E-01 -2.90E-02 -4.00E-01
Oral cancer 2B6E Oral tissue 9.73E-07 -3.96E-01 -1.33E+00
Osteoarthritis FA00-FA0Z Synovial tissue 7.65E-01 -6.89E-02 -9.61E-02
Osteoporosis FB83.1 Bone marrow 3.48E-01 5.15E-01 1.81E+00
Ovarian cancer 2C73 Ovarian tissue 5.58E-01 2.07E-01 4.95E-01
Pancreatic cancer 2C10 Pancreas 2.70E-01 -1.59E-01 -3.94E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.60E-01 1.64E-01 7.14E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.57E-01 1.61E-01 7.84E-01
Pituitary cancer 2D12 Pituitary tissue 2.25E-01 1.74E-01 7.03E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.98E-03 3.85E-01 1.99E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.57E-01 3.21E-02 2.17E-01
Polycythemia vera 2A20.4 Whole blood 2.26E-01 3.34E-02 2.72E-01
Pompe disease 5C51.3 Biceps muscle 7.40E-03 1.53E-01 1.07E+00
Preterm birth KA21.4Z Myometrium 3.66E-01 2.53E-01 8.76E-01
Prostate cancer 2C82 Prostate 9.20E-01 1.28E-02 3.23E-02
Psoriasis EA90 Skin 3.66E-09 1.87E-01 6.57E-01
Rectal cancer 2B92 Rectal colon tissue 1.34E-02 -3.68E-01 -1.74E+00
Renal cancer 2C90-2C91 Kidney 6.13E-01 -1.81E-02 -5.58E-02
Retinoblastoma 2D02.2 Uvea 4.04E-02 1.87E-01 1.10E+00
Rheumatoid arthritis FA20 Synovial tissue 4.51E-03 5.37E-01 1.81E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.66E-02 -5.88E-02 -5.12E-01
Schizophrenia 6A20 Prefrontal cortex 4.47E-01 1.40E-01 3.96E-01
Schizophrenia 6A20 Superior temporal cortex 2.78E-01 -5.25E-02 -5.05E-01
Scleroderma 4A42.Z Whole blood 4.79E-02 9.16E-02 6.06E-01
Seizure 8A60-8A6Z Whole blood 2.78E-01 -1.18E-01 -6.40E-01
Sensitive skin EK0Z Skin 6.07E-01 3.13E-03 2.08E-02
Sepsis with septic shock 1G41 Whole blood 1.27E-04 6.17E-02 1.95E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.61E-01 -7.06E-02 -6.46E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.07E-03 2.51E-01 1.72E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 9.83E-01 -1.26E-01 -6.84E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.64E-01 -2.43E-01 -3.73E+00
Skin cancer 2C30-2C3Z Skin 5.88E-12 2.47E-01 8.26E-01
Thrombocythemia 3B63 Whole blood 5.29E-01 -1.87E-03 -1.58E-02
Thrombocytopenia 3B64 Whole blood 3.55E-01 7.63E-01 9.26E-01
Thyroid cancer 2D10 Thyroid 6.41E-06 1.97E-01 8.15E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.99E-01 -1.02E-01 -4.26E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.12E-01 4.07E-01 2.66E+00
Type 2 diabetes 5A11 Liver tissue 2.45E-01 -2.06E-01 -5.48E-01
Ureter cancer 2C92 Urothelium 8.07E-01 -6.96E-02 -3.02E-01
Uterine cancer 2C78 Endometrium tissue 3.40E-16 -3.77E-01 -6.64E-01
Vitiligo ED63.0 Skin 2.47E-01 -3.54E-02 -1.48E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Cerebroside-sulfatase (ARSA) DTT Info
DME DTT Type Successful
1 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
OTL-200 DMQNI7O Metachromatic leukodystrophy 5C56.02 Approved [1]
1 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
HGT-1111 DMDZE3B Metachromatic leukodystrophy 5C56.02 Phase 2 [2]

References

1 Clinical pipeline report, company report or official report of Orchard Therapeutics.
2 ClinicalTrials.gov (NCT00681811) Open-Label Extension Study of Recombinant Human Arylsulfatase A (HGT-1111) in Late Infantile MLD. U.S. National Institutes of Health.
3 The echinocandin micafungin: a review of the pharmacology, spectrum of activity, clinical efficacy and safety. Expert Opin Pharmacother. 2007 Jun;8(8):1155-66.