Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEJHG19)

DME Name Peroxisomal multifunctional enzyme 2 (HSD17B4)
Synonyms
Peroxisomal multifunctional enzyme type 2; (3R)-hydroxyacyl-CoA dehydrogenase; 17-beta-HSD 4; 17-beta-hydroxysteroid dehydrogenase 4; 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase; D-bifunctional protein; Enoyl-CoA hydratase 2; Multifunctional protein 2; SDR8C1; Short chain dehydrogenase/reductase family 8C member 1; DBP; EDH17B4; HSD17B4; MFE-2; MPF-2
Gene Name HSD17B4
UniProt ID
DHB4_HUMAN
INTEDE ID
DME0263
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
3295
EC Number EC: 4.2.1.119
Lyases
Carbon-oxygen lyase
Hydro-lyase
EC: 4.2.1.119
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MGSPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVE
EIRRRGGKAVANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIH
RVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAI
EGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVG
AGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLS
KIDSEGGVSANHTSRATSTATSGFAGAIGQKLPPFSYAYTELEAIMYALGVGASIKDPKD
LKFIYEGSSDFSCLPTFGVIIGQKSMMGGGLAEIPGLSINFAKVLHGEQYLELYKPLPRA
GKLKCEAVVADVLDKGSGVVIIMDVYSYSEKELICHNQFSLFLVGSGGFGGKRTSDKVKV
AVAIPNRPPDAVLTDTTSLNQAALYRLSGDWNPLHIDPNFASLAGFDKPILHGLCTFGFS
ARRVLQQFADNDVSRFKAIKARFAKPVYPGQTLQTEMWKEGNRIHFQTKVQETGDIVISN
AYVDLAPTSGTSAKTPSEGGKLQSTFVFEEIGRRLKDIGPEVVKKVNAVFEWHITKGGNI
GAKWTIDLKSGSGKVYQGPAKGAADTTIILSDEDFMEVVLGKLDPQKAFFSGRLKARGNI
MLSQKLQMILKDYAKL
Function This enzyme acts on the peroxisomal beta-oxidation pathway for fatty acids and catalyzes the formation of 3-ketoacyl-CoA intermediates from both straight-chain and 2-methyl-branched-chain fatty acids.
KEGG Pathway
Biosynthesis of unsaturated fatty acids (hsa01040 )
Fatty acid metabolism (hsa01212 )
Metabolic pathways (hsa01100 )
Peroxisome (hsa04146 )
Primary bile acid biosynthesis (hsa00120 )
Reactome Pathway
Beta-oxidation of very long chain fatty acids (R-HSA-390247 )
Peroxisomal protein import (R-HSA-9033241 )
Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol (R-HSA-193368 )
TYSND1 cleaves peroxisomal proteins (R-HSA-9033500 )
alpha-linolenic acid (ALA) metabolism (R-HSA-2046106 )
Beta-oxidation of pristanoyl-CoA (R-HSA-389887 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
2 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Estrone DM5T6US Acne vulgaris ED80 Approved [3]
Prasterone DM67VKL Chronic obstructive pulmonary disease CA22 Approved [3]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.99E-01 3.82E-02 1.24E-01
Alopecia ED70 Skin from scalp 5.16E-01 1.73E-02 8.71E-02
Alzheimer's disease 8A20 Entorhinal cortex 1.09E-06 1.30E-01 6.12E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.65E-02 1.06E-01 9.63E-01
Aortic stenosis BB70 Calcified aortic valve 8.35E-01 -1.15E-01 -1.45E-01
Apnea 7A40 Hyperplastic tonsil 6.78E-01 2.46E-01 9.51E-01
Arthropathy FA00-FA5Z Peripheral blood 5.18E-01 4.51E-02 3.44E-01
Asthma CA23 Nasal and bronchial airway 1.24E-01 -1.34E-03 -4.57E-03
Atopic dermatitis EA80 Skin 2.02E-03 -1.66E-01 -1.81E+00
Autism 6A02 Whole blood 7.00E-03 1.02E-01 6.10E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.16E-01 2.22E-01 6.36E-01
Autosomal dominant monocytopenia 4B04 Whole blood 3.43E-02 6.74E-01 1.24E+00
Bacterial infection of gingival 1C1H Gingival tissue 2.58E-05 -8.11E-02 -5.73E-01
Batten disease 5C56.1 Whole blood 2.95E-01 -1.13E-01 -1.64E+00
Behcet's disease 4A62 Peripheral blood 6.10E-01 2.27E-02 1.14E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.25E-01 3.54E-02 2.97E-01
Bladder cancer 2C94 Bladder tissue 1.07E-03 -4.44E-01 -2.10E+00
Breast cancer 2C60-2C6Z Breast tissue 2.49E-03 6.37E-02 2.19E-01
Cardioembolic stroke 8B11.20 Whole blood 7.20E-04 1.11E-01 8.43E-01
Cervical cancer 2C77 Cervical tissue 9.66E-04 -3.62E-02 -2.26E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.74E-01 7.42E-02 2.19E-01
Chronic hepatitis C 1E51.1 Whole blood 2.22E-01 -1.22E-02 -5.35E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 4.55E-01 -4.16E-03 -3.51E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.73E-01 -1.74E-02 -9.46E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.15E-01 1.06E-01 5.61E-01
Colon cancer 2B90 Colon tissue 5.04E-01 1.47E-04 9.25E-04
Coronary artery disease BA80-BA8Z Peripheral blood 8.01E-01 8.64E-02 2.59E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.04E-01 -5.64E-02 -3.37E-01
Endometriosis GA10 Endometrium tissue 3.68E-02 -9.40E-02 -6.22E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.97E-01 2.70E-02 2.33E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.12E-14 5.61E-01 1.91E+00
Gastric cancer 2B72 Gastric tissue 4.88E-01 3.05E-03 7.78E-03
Glioblastopma 2A00.00 Nervous tissue 3.99E-08 -7.96E-02 -3.22E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.23E-02 -1.37E-01 -2.56E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.09E-01 -1.23E-01 -5.41E-01
Head and neck cancer 2D42 Head and neck tissue 4.29E-24 -2.86E-01 -1.79E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.02E-01 9.71E-02 3.61E-01
Huntington's disease 8A01.10 Whole blood 9.39E-01 -1.13E-02 -4.70E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.00E-02 -4.57E-01 -2.34E+00
Immunodeficiency 4A00-4A20 Peripheral blood 3.79E-01 -4.43E-02 -5.09E-01
Influenza 1E30 Whole blood 9.20E-04 3.35E-01 4.69E+00
Interstitial cystitis GC00.3 Bladder tissue 2.36E-03 -3.18E-01 -2.10E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.51E-02 2.07E-01 1.43E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 9.10E-01 -1.72E-02 -9.06E-02
Ischemic stroke 8B11 Peripheral blood 9.17E-01 9.58E-03 6.57E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 2.14E-01 -8.47E-02 -2.18E-01
Lateral sclerosis 8B60.4 Skin 2.81E-01 1.06E-01 8.32E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 7.17E-01 -3.47E-01 -9.13E-01
Liver cancer 2C12.0 Liver tissue 5.48E-01 -2.15E-02 -8.60E-02
Liver failure DB99.7-DB99.8 Liver tissue 3.04E-04 -6.65E-01 -4.00E+00
Lung cancer 2C25 Lung tissue 2.76E-65 -3.24E-01 -1.84E+00
Lupus erythematosus 4A40 Whole blood 4.40E-05 2.42E-01 5.30E-01
Major depressive disorder 6A70-6A7Z Hippocampus 3.66E-01 -3.78E-02 -3.17E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.73E-01 7.08E-02 2.87E-01
Melanoma 2C30 Skin 4.84E-05 -2.57E-01 -9.10E-01
Multiple myeloma 2A83.1 Peripheral blood 1.55E-01 -1.33E-01 -6.21E-01
Multiple myeloma 2A83.1 Bone marrow 2.99E-05 4.73E-01 3.19E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.65E-01 -2.57E-02 -1.57E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.84E-01 6.07E-03 2.05E-02
Myelofibrosis 2A20.2 Whole blood 3.39E-01 -1.16E-01 -1.04E+00
Myocardial infarction BA41-BA50 Peripheral blood 2.72E-03 -3.04E-01 -4.78E-01
Myopathy 8C70.6 Muscle tissue 1.15E-01 1.06E-01 9.16E-01
Neonatal sepsis KA60 Whole blood 1.37E-04 1.65E-01 7.70E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.98E-01 1.30E-02 7.25E-02
Non-alcoholic fatty liver disease DB92 Liver tissue 2.45E-01 -1.02E-01 -6.15E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.73E-01 9.13E-02 4.07E-01
Olive pollen allergy CA08.00 Peripheral blood 1.99E-01 2.90E-01 6.66E-01
Oral cancer 2B6E Oral tissue 9.53E-02 -1.07E-01 -3.48E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.74E-01 -1.91E-01 -4.82E-01
Osteoporosis FB83.1 Bone marrow 8.24E-01 -8.34E-02 -3.76E-01
Ovarian cancer 2C73 Ovarian tissue 2.83E-01 4.15E-02 1.70E-01
Pancreatic cancer 2C10 Pancreas 3.26E-02 -8.53E-02 -7.90E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.38E-01 9.67E-02 5.37E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.81E-01 2.91E-02 2.26E-01
Pituitary cancer 2D12 Pituitary tissue 5.19E-01 -6.42E-02 -2.68E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.28E-01 -2.52E-02 -2.66E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.11E-01 6.17E-02 6.15E-01
Polycythemia vera 2A20.4 Whole blood 1.08E-02 -8.25E-02 -8.66E-01
Pompe disease 5C51.3 Biceps muscle 8.75E-01 -4.53E-02 -4.33E-01
Preterm birth KA21.4Z Myometrium 3.38E-01 8.03E-02 4.30E-01
Prostate cancer 2C82 Prostate 4.23E-06 5.16E-01 1.35E+00
Psoriasis EA90 Skin 9.29E-23 2.02E-01 9.22E-01
Rectal cancer 2B92 Rectal colon tissue 3.63E-01 -1.84E-02 -2.91E-01
Renal cancer 2C90-2C91 Kidney 9.83E-01 8.75E-03 5.11E-02
Retinoblastoma 2D02.2 Uvea 3.56E-02 -7.95E-02 -9.54E-01
Rheumatoid arthritis FA20 Synovial tissue 9.58E-02 -4.87E-01 -1.11E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.75E-01 2.31E-02 2.61E-01
Schizophrenia 6A20 Prefrontal cortex 7.42E-01 -1.98E-03 -1.51E-02
Schizophrenia 6A20 Superior temporal cortex 9.87E-01 2.10E-04 1.76E-03
Scleroderma 4A42.Z Whole blood 1.21E-01 -8.33E-02 -8.23E-01
Seizure 8A60-8A6Z Whole blood 8.49E-02 -6.11E-02 -6.28E-01
Sensitive skin EK0Z Skin 6.72E-01 4.14E-02 4.98E-01
Sepsis with septic shock 1G41 Whole blood 2.13E-02 -4.33E-02 -1.95E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.14E-02 -1.41E-01 -7.78E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.04E-01 -1.43E-01 -5.65E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.12E-01 3.53E-02 9.53E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.90E-01 1.02E-01 6.66E-01
Skin cancer 2C30-2C3Z Skin 4.42E-05 -1.56E-01 -7.97E-01
Thrombocythemia 3B63 Whole blood 1.16E-01 -6.86E-02 -6.41E-01
Thrombocytopenia 3B64 Whole blood 9.17E-01 -1.76E-01 -5.45E-01
Thyroid cancer 2D10 Thyroid 4.80E-14 -2.38E-01 -1.26E+00
Tibial muscular dystrophy 8C75 Muscle tissue 8.37E-03 -1.16E-01 -7.40E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.22E-01 5.64E-02 6.25E-01
Type 2 diabetes 5A11 Liver tissue 2.59E-01 1.69E-01 9.86E-01
Ureter cancer 2C92 Urothelium 7.65E-01 1.00E-01 2.22E-01
Uterine cancer 2C78 Endometrium tissue 1.02E-01 5.76E-02 2.12E-01
Vitiligo ED63.0 Skin 7.84E-01 3.80E-02 1.92E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Estradiol 17 beta-dehydrogenase 4 (HSD17B4) DTT Info
DME DTT Type Literature-reported
2 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
3r-Hydroxydecanoyl-Coa DMV1HMX Discovery agent N.A. Investigative [1]
Nicotinamide-Adenine-Dinucleotide DM9LRKB N. A. N. A. Investigative [2]

References

1 DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41.
2 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
3 Steroid signalling in the ovarian surface epithelium. Trends Endocrinol Metab. 2005 Sep;16(7):327-33.