Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEK6079)

DME Name Glutathione S-transferase pi (GSTP1)
Synonyms Glutathione S-transferase Pi; Glutathione S-transferase P; FAEES3; GST class-pi; GST3; GSTP1; GSTP1-1
Gene Name GSTP1
UniProt ID
GSTP1_HUMAN
INTEDE ID
DME0088
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
2950
EC Number EC: 2.5.1.18
Transferase
Alkyl/aryl transferase
Alkyl/aryl transferase
EC: 2.5.1.18
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGD
LTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYV
KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY
VGRLSARPKLKAFLASPEYVNLPINGNGKQ
Function This enzyme conjugates reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
KEGG Pathway
Chemical carcinogenesis (hsa05204 )
Drug metabolism - cytochrome P450 (hsa00982 )
Drug metabolism - other enzymes (hsa00983 )
Fluid shear stress and atherosclerosis (hsa05418 )
Glutathione metabolism (hsa00480 )
Hepatocellular carcinoma (hsa05225 )
Metabolic pathways (hsa01100 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Pathways in cancer (hsa05200 )
Platinum drug resistance (hsa01524 )
Prostate cancer (hsa05215 )
Reactome Pathway
Glutathione conjugation (R-HSA-156590 )
Neutrophil degranulation (R-HSA-6798695 )
Detoxification of Reactive Oxygen Species (R-HSA-3299685 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
6 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Busulfan DMXYJ9C Chronic myelogenous leukaemia 2A20.0 Approved [3]
Carboplatin DMG281S Adenocarcinoma 2D40 Approved [4]
Chlorambucil DMRKE63 Chronic lymphocytic leukaemia 2A82.0 Approved [5]
Cisplatin DMRHGI9 Adenocarcinoma 2D40 Approved [6]
Etoposide DMNH3PG Acute myelogenous leukaemia 2A41 Approved [7]
Oxaliplatin DMQNWRD Adenocarcinoma 2D40 Approved [4]
⏷ Show the Full List of 6 Approved Drug(s)

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.13E-17 4.18E-01 1.02E+00
Alopecia ED70 Skin from scalp 8.37E-07 -3.43E-01 -1.12E+00
Alzheimer's disease 8A20 Entorhinal cortex 4.74E-03 1.08E-01 3.70E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.32E-01 3.20E-02 1.23E-01
Aortic stenosis BB70 Calcified aortic valve 6.89E-01 -6.12E-02 -1.11E-01
Apnea 7A40 Hyperplastic tonsil 4.50E-01 1.53E-02 4.46E-02
Arthropathy FA00-FA5Z Peripheral blood 3.64E-03 -1.80E-01 -9.19E-01
Asthma CA23 Nasal and bronchial airway 9.04E-04 2.05E-01 3.48E-01
Atopic dermatitis EA80 Skin 2.89E-07 3.95E-01 1.70E+00
Autism 6A02 Whole blood 2.72E-01 -9.75E-02 -2.15E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.78E-01 -1.00E-01 -4.79E-01
Autosomal dominant monocytopenia 4B04 Whole blood 8.38E-01 -6.77E-02 -2.77E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.88E-03 -1.49E-01 -4.56E-01
Batten disease 5C56.1 Whole blood 6.94E-01 1.05E-01 2.28E-01
Behcet's disease 4A62 Peripheral blood 7.69E-01 1.11E-02 4.62E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.38E-01 -8.75E-02 -5.07E-01
Bladder cancer 2C94 Bladder tissue 4.13E-03 5.14E-01 1.60E+00
Breast cancer 2C60-2C6Z Breast tissue 2.68E-19 -5.69E-01 -9.11E-01
Cardioembolic stroke 8B11.20 Whole blood 2.53E-10 -5.01E-01 -2.64E+00
Cervical cancer 2C77 Cervical tissue 5.64E-02 -1.56E-01 -3.05E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.57E-01 5.69E-02 5.82E-02
Chronic hepatitis C 1E51.1 Whole blood 4.11E-01 -1.25E-02 -3.69E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 1.12E-01 -1.44E-01 -3.41E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.57E-01 -1.22E-02 -3.43E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.32E-01 4.20E-03 5.44E-03
Colon cancer 2B90 Colon tissue 4.41E-44 7.73E-01 2.13E+00
Coronary artery disease BA80-BA8Z Peripheral blood 5.32E-02 5.04E-01 1.46E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.19E-01 -1.61E-01 -3.35E-01
Endometriosis GA10 Endometrium tissue 5.44E-01 1.18E-01 3.64E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.10E-02 -4.82E-01 -2.04E+00
Familial hypercholesterolemia 5C80.00 Whole blood 1.94E-21 1.30E+00 2.36E+00
Gastric cancer 2B72 Gastric tissue 4.94E-03 1.07E+00 7.14E+00
Glioblastopma 2A00.00 Nervous tissue 5.43E-75 6.27E-01 1.37E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 6.28E-01 -1.93E-01 -6.79E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.70E-02 9.41E-01 1.36E+00
Head and neck cancer 2D42 Head and neck tissue 1.07E-02 -2.56E-01 -5.41E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.81E-01 1.69E-01 5.06E-01
Huntington's disease 8A01.10 Whole blood 6.98E-01 -8.15E-02 -1.21E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.52E-03 4.94E-01 2.09E+00
Immunodeficiency 4A00-4A20 Peripheral blood 2.04E-01 1.94E-01 5.05E-01
Influenza 1E30 Whole blood 1.82E-01 1.96E-01 8.86E-01
Interstitial cystitis GC00.3 Bladder tissue 4.59E-03 -6.44E-01 -2.02E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.15E-01 -5.40E-03 -2.19E-02
Irritable bowel syndrome DD91.0 Rectal colon tissue 9.56E-02 -5.33E-01 -7.50E-01
Ischemic stroke 8B11 Peripheral blood 2.05E-01 -1.26E-01 -6.49E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.36E-11 -1.06E+00 -1.49E+00
Lateral sclerosis 8B60.4 Skin 7.56E-01 4.20E-02 2.16E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.19E-01 -1.69E-01 -6.63E-01
Liver cancer 2C12.0 Liver tissue 4.54E-04 -2.09E-01 -5.48E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.13E-05 2.08E+00 6.47E+00
Lung cancer 2C25 Lung tissue 5.91E-01 1.98E-01 4.79E-01
Lupus erythematosus 4A40 Whole blood 5.59E-02 2.97E-01 3.19E-01
Major depressive disorder 6A70-6A7Z Hippocampus 3.41E-01 1.07E-02 6.14E-02
Major depressive disorder 6A70-6A7Z Whole blood 6.64E-01 -1.02E-01 -1.69E-01
Melanoma 2C30 Skin 6.54E-02 2.37E-01 3.10E-01
Multiple myeloma 2A83.1 Peripheral blood 6.72E-01 -2.50E-01 -2.48E-01
Multiple myeloma 2A83.1 Bone marrow 1.51E-03 7.12E-01 2.34E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.02E-01 5.51E-01 1.33E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.46E-01 1.42E-02 3.12E-02
Myelofibrosis 2A20.2 Whole blood 8.82E-02 -1.85E-01 -6.44E-01
Myocardial infarction BA41-BA50 Peripheral blood 5.43E-01 -1.23E-01 -2.07E-01
Myopathy 8C70.6 Muscle tissue 2.33E-01 -5.78E-02 -2.19E-01
Neonatal sepsis KA60 Whole blood 7.38E-02 -1.71E-01 -3.53E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.35E-05 7.82E-01 2.29E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.71E-01 6.44E-02 2.26E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.63E-01 1.10E-02 4.68E-02
Olive pollen allergy CA08.00 Peripheral blood 2.19E-01 1.84E-01 3.05E-01
Oral cancer 2B6E Oral tissue 4.91E-01 1.72E-01 2.84E-01
Osteoarthritis FA00-FA0Z Synovial tissue 4.06E-01 4.58E-01 2.13E-01
Osteoporosis FB83.1 Bone marrow 4.39E-02 1.99E-01 1.44E+00
Ovarian cancer 2C73 Ovarian tissue 2.41E-03 1.02E+00 1.73E+00
Pancreatic cancer 2C10 Pancreas 1.31E-04 1.01E+00 1.38E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 6.18E-01 1.96E-01 7.08E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.31E-02 1.99E-01 5.91E-01
Pituitary cancer 2D12 Pituitary tissue 5.78E-01 6.28E-01 1.75E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.96E-03 7.51E-01 2.21E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.43E-01 7.62E-02 4.03E-01
Polycythemia vera 2A20.4 Whole blood 1.55E-06 -2.97E-01 -1.07E+00
Pompe disease 5C51.3 Biceps muscle 3.37E-03 3.55E-01 3.33E+00
Preterm birth KA21.4Z Myometrium 1.18E-01 -2.73E-01 -2.11E+00
Prostate cancer 2C82 Prostate 9.34E-09 -7.62E-01 -1.49E+00
Psoriasis EA90 Skin 5.20E-22 4.61E-01 1.58E+00
Rectal cancer 2B92 Rectal colon tissue 4.69E-03 3.36E-01 1.90E+00
Renal cancer 2C90-2C91 Kidney 1.67E-01 -6.92E-02 -1.82E-01
Retinoblastoma 2D02.2 Uvea 1.34E-01 6.98E-01 2.83E+00
Rheumatoid arthritis FA20 Synovial tissue 4.89E-07 2.52E+00 6.65E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.59E-01 -2.35E-02 -1.64E-01
Schizophrenia 6A20 Prefrontal cortex 1.46E-01 1.71E-01 2.32E-01
Schizophrenia 6A20 Superior temporal cortex 7.96E-01 5.27E-02 2.60E-01
Scleroderma 4A42.Z Whole blood 6.28E-08 -3.03E-01 -3.03E+00
Seizure 8A60-8A6Z Whole blood 4.87E-01 -8.83E-02 -3.61E-01
Sensitive skin EK0Z Skin 3.82E-01 1.26E-01 5.31E-01
Sepsis with septic shock 1G41 Whole blood 1.83E-06 -1.89E-01 -4.72E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.35E-02 -3.25E-01 -8.88E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.34E-01 8.62E-02 2.91E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.94E-01 1.61E-02 4.66E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.02E-02 -8.14E-01 -2.72E+00
Skin cancer 2C30-2C3Z Skin 1.08E-03 1.41E-01 3.81E-01
Thrombocythemia 3B63 Whole blood 2.20E-02 -4.03E-02 -1.45E-01
Thrombocytopenia 3B64 Whole blood 6.95E-01 5.02E-01 3.60E-01
Thyroid cancer 2D10 Thyroid 4.88E-16 -3.56E-01 -1.09E+00
Tibial muscular dystrophy 8C75 Muscle tissue 6.00E-01 -8.47E-02 -2.23E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.94E-01 2.10E-01 5.92E-01
Type 2 diabetes 5A11 Liver tissue 7.44E-01 6.56E-02 1.95E-01
Ureter cancer 2C92 Urothelium 5.71E-01 2.50E-02 6.77E-02
Uterine cancer 2C78 Endometrium tissue 2.12E-10 -2.42E-01 -3.50E-01
Vitiligo ED63.0 Skin 6.30E-01 3.45E-02 3.73E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Glutathione S-transferase P (GSTP1) DTT Info
DME DTT Type Clinical trial
2 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Canfosfamide DM4FHQR Solid tumour/cancer 2A00-2F9Z Phase 3 [1]
Ezatiostat DM2L9CO Myelodysplastic syndrome 2A37 Phase 2 [2]

References

1 Mechanism of glutathione transferase P1-1-catalyzed activation of the prodrug canfosfamide (TLK286, TELCYTA). Biochemistry. 2013 Nov 12;52(45):8069-78.
2 National Cancer Institute Drug Dictionary (drug id 485244).
3 Busulfan conjugation by glutathione S-transferases alpha, mu, and pi. Drug Metab Dispos. 1996 Sep;24(9):1015-9.
4 PharmGKB: A worldwide resource for pharmacogenomic information. Wiley Interdiscip Rev Syst Biol Med. 2018 Jul;10(4):e1417. (ID: PA150642262)
5 The anti-cancer drug chlorambucil as a substrate for the human polymorphic enzyme glutathione transferase P1-1: kinetic properties and crystallographic characterisation of allelic variants. J Mol Biol. 2008 Jun 27;380(1):131-44.
6 Glutathione S-transferase genetic polymorphisms and individual sensitivity to the ototoxic effect of cisplatin. Anticancer Drugs. 2000 Sep;11(8):639-43.
7 Reactions of glutathione with the catechol, the ortho-quinone and the semi-quinone free radical of etoposide. Consequences for DNA inactivation. Biochem Pharmacol. 1992 Apr 15;43(8):1761-8.