General Information of Drug-Metabolizing Enzyme (DME) (ID: DEKBXUC)

DME Name PABA peptide hydrolase (MEP1B)
Synonyms Endopeptidase-2; Meprin A subunit beta; Meprin B; N-benzoyl-L-tyrosyl-P-amino-benzoic acid hydrolase subunit beta; MEP1B; PPH beta
Gene Name MEP1B
UniProt ID
MEP1B_HUMAN
INTEDE ID
DME0580
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
4225
EC Number EC: 3.4.24.63
Hydrolases
Peptidase
Metallopeptidase
EC: 3.4.24.63
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MDLWNLSWFLFLDALLVISGLATPENFDVDGGMDQDIFDINEGLGLDLFEGDIRLDRAQI
RNSIIGEKYRWPHTIPYVLEDSLEMNAKGVILNAFERYRLKTCIDFKPWAGETNYISVFK
GSGCWSSVGNRRVGKQELSIGANCDRIATVQHEFLHALGFWHEQSRSDRDDYVRIMWDRI
LSGREHNFNTYSDDISDSLNVPYDYTSVMHYSKTAFQNGTEPTIVTRISDFEDVIGQRMD
FSDSDLLKLNQLYNCSSSLSFMDSCSFELENVCGMIQSSGDNADWQRVSQVPRGPESDHS
NMGQCQGSGFFMHFDSSSVNVGATAVLESRTLYPKRGFQCLQFYLYNSGSESDQLNIYIR
EYSADNVDGNLTLVEEIKEIPTGSWQLYHVTLKVTKKFRVVFEGRKGSGASLGGLSIDDI
NLSETRCPHHIWHIRNFTQFIGSPNGTLYSPPFYSSKGYAFQIYLNLAHVTNAGIYFHLI
SGANDDQLQWPCPWQQATMTLLDQNPDIRQRMSNQRSITTDPFMTTDNGNYFWDRPSKVG
TVALFSNGTQFRRGGGYGTSAFITHERLKSRDFIKGDDVYILLTVEDISHLNSTQIQLTP
APSVQDLCSKTTCKNDGVCTVRDGKAECRCQSGEDWWYMGERCEKRGSTRDTIVIAVSST
VAVFALMLIITLVSVYCTRKKYRERMSSNRPNLTPQNQHAF
Function
This enzyme exhibits a strong preference for acidic amino acids at the P1' position and known substrates include: FGF19, VGFA, IL1B, IL18, procollagen I and III, E-cadherin, KLK7, gastrin, ADAM10, tenascin-C.
KEGG Pathway
Protein digestion and absorption (hsa04974 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
BRADYKININ DM4R6UV N. A. N. A. Phase 1 [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.72E-01 -2.42E-02 -1.19E-01
Alopecia ED70 Skin from scalp 9.34E-01 1.80E-02 8.49E-02
Alzheimer's disease 8A20 Entorhinal cortex 2.77E-01 -4.77E-03 -2.38E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 1.98E-01 1.85E-01 9.08E-01
Aortic stenosis BB70 Calcified aortic valve 9.77E-01 9.65E-02 1.30E-01
Apnea 7A40 Hyperplastic tonsil 8.98E-01 9.14E-02 3.97E-01
Arthropathy FA00-FA5Z Peripheral blood 5.47E-01 -3.05E-02 -2.38E-01
Asthma CA23 Nasal and bronchial airway 3.37E-02 -1.20E-01 -1.87E-01
Atopic dermatitis EA80 Skin 2.97E-05 1.68E-01 8.96E-01
Autism 6A02 Whole blood 9.48E-01 4.97E-03 3.08E-02
Autoimmune uveitis 9A96 Peripheral monocyte 3.51E-02 -1.35E-01 -1.36E+00
Autosomal dominant monocytopenia 4B04 Whole blood 3.97E-01 -6.17E-02 -3.37E-01
Bacterial infection of gingival 1C1H Gingival tissue 5.04E-01 -4.60E-02 -9.70E-02
Batten disease 5C56.1 Whole blood 6.27E-01 -1.63E-02 -7.82E-02
Behcet's disease 4A62 Peripheral blood 4.25E-01 -5.70E-02 -2.01E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.38E-01 -6.01E-03 -3.02E-02
Bladder cancer 2C94 Bladder tissue 2.71E-07 1.10E+00 5.95E+00
Breast cancer 2C60-2C6Z Breast tissue 3.34E-11 -1.25E-01 -3.22E-01
Cardioembolic stroke 8B11.20 Whole blood 2.16E-02 1.08E-01 4.59E-01
Cervical cancer 2C77 Cervical tissue 8.30E-01 -2.22E-02 -8.11E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.51E-02 1.56E-01 1.05E+00
Chronic hepatitis C 1E51.1 Whole blood 1.17E-01 8.61E-02 3.72E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.10E-02 6.92E-02 3.94E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.54E-01 -2.44E-02 -1.51E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.25E-01 5.41E-02 2.78E-01
Colon cancer 2B90 Colon tissue 7.92E-36 -2.26E+00 -1.35E+00
Coronary artery disease BA80-BA8Z Peripheral blood 2.18E-01 -9.74E-02 -6.03E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.85E-01 1.07E-02 5.71E-02
Endometriosis GA10 Endometrium tissue 2.35E-01 7.54E-02 3.03E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.61E-01 -2.55E-02 -1.81E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.93E-01 -1.05E-01 -4.75E-01
Gastric cancer 2B72 Gastric tissue 5.98E-02 -1.40E-01 -9.17E-01
Glioblastopma 2A00.00 Nervous tissue 5.94E-07 -1.76E-01 -4.20E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.74E-01 -3.87E-02 -4.57E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.92E-03 -7.02E-01 -1.65E+00
Head and neck cancer 2D42 Head and neck tissue 1.51E-01 -3.79E-02 -1.78E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.70E-01 -1.27E-02 -4.08E-02
Huntington's disease 8A01.10 Whole blood 3.87E-01 -1.12E-02 -4.58E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.68E-01 1.30E-02 1.09E-01
Immunodeficiency 4A00-4A20 Peripheral blood 7.99E-01 -3.20E-03 -2.23E-02
Influenza 1E30 Whole blood 4.52E-01 2.96E-01 1.21E+00
Interstitial cystitis GC00.3 Bladder tissue 6.61E-01 -2.59E-02 -4.20E-01
Intracranial aneurysm 8B01.0 Intracranial artery 2.67E-01 -1.13E-01 -4.06E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.07E-01 4.58E-02 1.04E-01
Ischemic stroke 8B11 Peripheral blood 7.86E-01 2.60E-02 1.21E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.67E-01 7.82E-02 2.67E-01
Lateral sclerosis 8B60.4 Skin 3.51E-02 1.53E-01 1.71E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 9.78E-01 5.86E-02 2.27E-01
Liver cancer 2C12.0 Liver tissue 6.71E-07 -7.22E-01 -9.27E-01
Liver failure DB99.7-DB99.8 Liver tissue 7.05E-01 -2.29E-02 -8.23E-02
Lung cancer 2C25 Lung tissue 3.18E-02 3.07E-02 1.50E-01
Lupus erythematosus 4A40 Whole blood 3.93E-01 2.43E-02 7.04E-02
Major depressive disorder 6A70-6A7Z Hippocampus 4.01E-01 3.49E-02 2.07E-01
Major depressive disorder 6A70-6A7Z Whole blood 6.54E-02 6.34E-02 2.31E-01
Melanoma 2C30 Skin 7.11E-01 1.43E-01 2.42E-01
Multiple myeloma 2A83.1 Peripheral blood 5.44E-02 2.03E-01 1.07E+00
Multiple myeloma 2A83.1 Bone marrow 2.02E-05 -9.83E-01 -3.98E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.95E-01 -1.66E-01 -4.70E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.99E-02 -5.61E-02 -1.79E-01
Myelofibrosis 2A20.2 Whole blood 1.35E-01 -4.93E-02 -3.72E-01
Myocardial infarction BA41-BA50 Peripheral blood 8.11E-01 1.43E-01 1.89E-01
Myopathy 8C70.6 Muscle tissue 9.87E-01 -6.26E-02 -3.13E-01
Neonatal sepsis KA60 Whole blood 8.20E-01 -9.21E-03 -5.12E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 9.96E-05 -8.82E-01 -2.43E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.10E-03 1.18E+00 3.46E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.57E-02 1.21E-01 1.29E+00
Olive pollen allergy CA08.00 Peripheral blood 6.03E-01 1.42E-01 5.02E-01
Oral cancer 2B6E Oral tissue 1.44E-01 -3.65E-01 -9.10E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.28E-01 3.47E-02 9.36E-02
Osteoporosis FB83.1 Bone marrow 5.14E-02 2.19E-01 1.24E+00
Ovarian cancer 2C73 Ovarian tissue 3.35E-01 -3.68E-01 -9.29E-01
Pancreatic cancer 2C10 Pancreas 6.95E-01 -1.18E-01 -1.56E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.95E-01 5.20E-02 2.23E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.00E-01 -2.73E-02 -2.44E-01
Pituitary cancer 2D12 Pituitary tissue 2.07E-02 3.17E-01 9.39E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 9.58E-02 2.98E-01 1.11E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.00E-01 1.52E-03 5.07E-03
Polycythemia vera 2A20.4 Whole blood 3.55E-05 1.66E-01 1.27E+00
Pompe disease 5C51.3 Biceps muscle 7.30E-01 -1.94E-02 -8.87E-02
Preterm birth KA21.4Z Myometrium 7.94E-01 9.47E-04 4.97E-03
Prostate cancer 2C82 Prostate 2.14E-01 -1.68E-01 -4.27E-01
Psoriasis EA90 Skin 2.79E-02 -1.62E-02 -5.95E-02
Rectal cancer 2B92 Rectal colon tissue 1.67E-01 -5.90E-01 -3.84E-01
Renal cancer 2C90-2C91 Kidney 5.10E-02 -3.77E-01 -1.13E+00
Retinoblastoma 2D02.2 Uvea 9.95E-01 4.47E-02 2.95E-01
Rheumatoid arthritis FA20 Synovial tissue 3.96E-02 5.22E-01 1.48E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.09E-02 6.18E-02 4.37E-01
Schizophrenia 6A20 Prefrontal cortex 6.53E-01 -2.46E-02 -5.72E-02
Schizophrenia 6A20 Superior temporal cortex 1.36E-02 -1.23E-01 -9.36E-01
Scleroderma 4A42.Z Whole blood 2.20E-02 1.27E-01 6.30E-01
Seizure 8A60-8A6Z Whole blood 2.29E-01 -1.59E-01 -6.06E-01
Sensitive skin EK0Z Skin 6.93E-01 6.58E-02 3.88E-01
Sepsis with septic shock 1G41 Whole blood 1.39E-02 1.17E-01 4.79E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.44E-02 9.29E-01 1.38E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.00E-02 2.38E-01 1.16E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 6.90E-01 1.49E-02 1.36E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 9.34E-01 -2.47E-01 -9.65E-01
Skin cancer 2C30-2C3Z Skin 1.78E-10 1.36E-01 4.38E-01
Thrombocythemia 3B63 Whole blood 1.33E-03 1.10E-01 7.70E-01
Thrombocytopenia 3B64 Whole blood 8.32E-01 -5.95E-02 -2.83E-01
Thyroid cancer 2D10 Thyroid 2.14E-02 5.38E-02 2.17E-01
Tibial muscular dystrophy 8C75 Muscle tissue 9.52E-02 -8.54E-02 -5.45E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 6.45E-01 -2.24E-02 -1.69E-01
Type 2 diabetes 5A11 Liver tissue 6.73E-01 1.24E-01 1.81E-01
Ureter cancer 2C92 Urothelium 5.40E-01 3.27E-02 1.73E-01
Uterine cancer 2C78 Endometrium tissue 5.11E-03 -1.69E-01 -4.06E-01
Vitiligo ED63.0 Skin 8.75E-01 3.35E-02 3.08E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Human and mouse homo-oligomeric meprin A metalloendopeptidase: substrate and inhibitor specificities. Biol Chem. 2007 Nov;388(11):1163-72.