Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEKF1OH)

DME Name Methionine adenosyltransferase II beta (MAT2B)
Synonyms Methionine adenosyltransferase 2 subunit beta; Putative dTDP-4-keto-6-deoxy-D-glucose 4-reductase; MAT II beta; MAT2B; MSTP045; Nbla02999; TGR; UNQ2435/PRO4995
Gene Name MAT2B
UniProt ID
MAT2B_HUMAN
INTEDE ID
DME0183
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
27430
EC Number EC: 2.5.1.6
Transferase
Alkyl/aryl transferase
Alkyl/aryl transferase
EC: 2.5.1.6
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MVGREKELSIHFVPGSCRLVEEEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGF
RRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNL
AKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVL
RIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRML
DPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNAQLDCSKL
ETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH
Function This enzyme is a regulatory subunit of S-adenosylmethionine synthetase 2, an enzyme that catalyzes the formation of S-adenosylmethionine from methionine and ATP.
KEGG Pathway
Biosynthesis of amino acids (hsa01230 )
Cysteine and methionine metabolism (hsa00270 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Ub-specific processing proteases (R-HSA-5689880 )
Methylation (R-HSA-156581 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-methionine DME8G1U Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
L-methionine Discovery agent [N.A.] Investigative Km = 0.022 microM [2]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.10E-25 -3.52E-01 -1.32E+00
Alopecia ED70 Skin from scalp 2.20E-01 2.91E-04 1.15E-03
Alzheimer's disease 8A20 Entorhinal cortex 3.65E-03 -9.28E-02 -3.24E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.23E-01 4.28E-03 1.31E-02
Aortic stenosis BB70 Calcified aortic valve 7.27E-01 -1.34E-01 -1.99E-01
Apnea 7A40 Hyperplastic tonsil 3.27E-02 3.39E-01 2.37E+00
Arthropathy FA00-FA5Z Peripheral blood 7.76E-01 5.70E-02 3.75E-01
Asthma CA23 Nasal and bronchial airway 1.99E-03 -1.58E-01 -1.84E-01
Atopic dermatitis EA80 Skin 2.31E-02 -2.19E-01 -1.04E+00
Autism 6A02 Whole blood 6.95E-01 -6.70E-03 -2.43E-02
Autoimmune uveitis 9A96 Peripheral monocyte 4.56E-01 -6.76E-02 -1.57E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.37E-01 -7.20E-01 -1.39E+00
Bacterial infection of gingival 1C1H Gingival tissue 2.77E-02 8.35E-02 3.49E-01
Batten disease 5C56.1 Whole blood 6.02E-02 -1.70E-01 -1.16E+00
Behcet's disease 4A62 Peripheral blood 5.58E-01 9.67E-02 2.89E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.56E-01 -9.65E-02 -3.56E-01
Bladder cancer 2C94 Bladder tissue 2.69E-02 -3.71E-01 -1.15E+00
Breast cancer 2C60-2C6Z Breast tissue 3.37E-35 -2.25E-01 -9.21E-01
Cardioembolic stroke 8B11.20 Whole blood 2.76E-08 4.53E-01 2.21E+00
Cervical cancer 2C77 Cervical tissue 4.80E-01 6.17E-02 2.69E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.01E-01 1.56E-01 8.08E-01
Chronic hepatitis C 1E51.1 Whole blood 1.38E-01 -8.52E-02 -4.69E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.40E-01 4.04E-02 1.34E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.13E-02 -1.15E-01 -4.40E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.35E-01 -7.51E-02 -4.34E-01
Colon cancer 2B90 Colon tissue 1.13E-17 -2.80E-01 -8.11E-01
Coronary artery disease BA80-BA8Z Peripheral blood 1.12E-01 1.30E-01 3.06E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.66E-01 3.24E-02 1.99E-01
Endometriosis GA10 Endometrium tissue 2.34E-01 2.59E-01 5.21E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.59E-02 -1.59E-01 -8.75E-01
Familial hypercholesterolemia 5C80.00 Whole blood 4.81E-05 -4.53E-01 -2.23E+00
Gastric cancer 2B72 Gastric tissue 7.70E-01 -5.36E-02 -1.62E-01
Glioblastopma 2A00.00 Nervous tissue 3.64E-45 -2.98E-01 -8.63E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.07E-01 1.48E-01 3.87E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.16E-01 -5.03E-02 -2.06E-01
Head and neck cancer 2D42 Head and neck tissue 1.34E-05 -2.16E-01 -7.09E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.06E-01 -1.77E-01 -6.97E-01
Huntington's disease 8A01.10 Whole blood 6.51E-01 -6.04E-02 -3.51E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.83E-01 -4.20E-02 -1.73E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.42E-01 -1.36E-01 -9.27E-01
Influenza 1E30 Whole blood 3.07E-01 1.17E-01 7.47E-01
Interstitial cystitis GC00.3 Bladder tissue 4.24E-01 -1.02E-02 -7.04E-02
Intracranial aneurysm 8B01.0 Intracranial artery 8.58E-01 4.96E-02 3.18E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.61E-02 -1.98E-01 -6.05E-01
Ischemic stroke 8B11 Peripheral blood 4.67E-01 -1.35E-01 -3.38E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.56E-01 2.13E-02 5.42E-02
Lateral sclerosis 8B60.4 Skin 3.39E-01 2.63E-01 1.13E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 8.46E-02 -2.97E-01 -8.35E-01
Liver cancer 2C12.0 Liver tissue 9.30E-03 -1.19E-01 -3.14E-01
Liver failure DB99.7-DB99.8 Liver tissue 8.02E-03 -2.37E-01 -1.15E+00
Lung cancer 2C25 Lung tissue 9.91E-07 -1.92E-01 -5.82E-01
Lupus erythematosus 4A40 Whole blood 7.90E-06 1.05E+00 1.44E+00
Major depressive disorder 6A70-6A7Z Hippocampus 8.17E-01 -1.04E-01 -4.04E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.46E-01 7.84E-03 3.69E-02
Melanoma 2C30 Skin 2.74E-01 1.39E-02 3.70E-02
Multiple myeloma 2A83.1 Peripheral blood 1.59E-01 9.03E-02 6.54E-01
Multiple myeloma 2A83.1 Bone marrow 2.11E-01 -1.15E-01 -3.86E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.52E-01 -6.46E-02 -3.54E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.58E-02 -6.59E-02 -3.93E-01
Myelofibrosis 2A20.2 Whole blood 2.93E-04 -1.67E-01 -1.19E+00
Myocardial infarction BA41-BA50 Peripheral blood 7.43E-04 -4.79E-01 -6.02E-01
Myopathy 8C70.6 Muscle tissue 1.95E-01 2.62E-01 1.06E+00
Neonatal sepsis KA60 Whole blood 1.31E-01 -7.78E-02 -2.51E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.70E-01 4.09E-02 2.27E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 6.74E-01 -2.24E-02 -9.20E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.57E-01 -1.62E-01 -5.44E-01
Olive pollen allergy CA08.00 Peripheral blood 4.17E-01 1.34E-01 6.33E-01
Oral cancer 2B6E Oral tissue 4.69E-02 9.59E-02 3.37E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.02E-01 8.43E-02 4.32E-01
Osteoporosis FB83.1 Bone marrow 4.47E-03 -4.14E-01 -2.19E+00
Ovarian cancer 2C73 Ovarian tissue 9.07E-01 -1.06E-01 -4.01E-01
Pancreatic cancer 2C10 Pancreas 2.23E-03 3.21E-01 1.31E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 9.24E-01 -7.99E-02 -2.98E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.39E-01 -1.00E-01 -5.14E-01
Pituitary cancer 2D12 Pituitary tissue 9.80E-01 -1.02E-01 -7.04E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.84E-02 -1.71E-01 -1.34E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.97E-01 -6.35E-02 -5.49E-01
Polycythemia vera 2A20.4 Whole blood 1.65E-06 -2.07E-01 -1.29E+00
Pompe disease 5C51.3 Biceps muscle 5.54E-04 -4.36E-01 -3.10E+00
Preterm birth KA21.4Z Myometrium 8.34E-01 1.37E-01 3.89E-01
Prostate cancer 2C82 Prostate 3.53E-03 6.60E-01 1.32E+00
Psoriasis EA90 Skin 1.67E-03 3.74E-02 1.10E-01
Rectal cancer 2B92 Rectal colon tissue 2.52E-01 -4.21E-02 -1.68E-01
Renal cancer 2C90-2C91 Kidney 3.50E-01 1.06E-01 4.15E-01
Retinoblastoma 2D02.2 Uvea 9.48E-03 -3.00E-01 -1.21E+00
Rheumatoid arthritis FA20 Synovial tissue 2.59E-02 3.48E-01 1.57E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.30E-01 3.39E-02 2.33E-01
Schizophrenia 6A20 Prefrontal cortex 6.18E-01 -9.94E-03 -2.44E-02
Schizophrenia 6A20 Superior temporal cortex 6.34E-01 -2.44E-02 -1.17E-01
Scleroderma 4A42.Z Whole blood 5.45E-05 1.49E-01 2.07E+00
Seizure 8A60-8A6Z Whole blood 3.91E-01 6.70E-03 4.30E-02
Sensitive skin EK0Z Skin 7.00E-01 -1.23E-02 -7.04E-02
Sepsis with septic shock 1G41 Whole blood 2.67E-25 -2.99E-01 -1.08E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.92E-02 4.06E-01 1.17E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.81E-01 2.09E-01 6.37E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 2.45E-01 -3.63E-02 -3.41E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.57E-03 3.14E-01 4.74E+00
Skin cancer 2C30-2C3Z Skin 1.81E-05 1.39E-01 4.04E-01
Thrombocythemia 3B63 Whole blood 7.02E-08 -2.39E-01 -1.67E+00
Thrombocytopenia 3B64 Whole blood 2.95E-01 -3.86E-01 -5.89E-01
Thyroid cancer 2D10 Thyroid 4.40E-04 -1.42E-01 -4.78E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.85E-02 -1.69E-01 -6.50E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.59E-02 -5.31E-01 -2.14E+00
Type 2 diabetes 5A11 Liver tissue 5.87E-01 6.91E-02 4.72E-01
Ureter cancer 2C92 Urothelium 6.79E-01 -1.56E-01 -3.71E-01
Uterine cancer 2C78 Endometrium tissue 1.37E-04 -1.71E-01 -4.93E-01
Vitiligo ED63.0 Skin 6.89E-01 4.84E-02 4.92E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
2 Cloning, expression, and functional characterization of the beta regulatory subunit of human methionine adenosyltransferase (MAT II). J Biol Chem. 2000 Jan 28;275(4):2359-66.