Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEL7GFA)

DME Name Sterol Delta(7)-reductase (DHCR7)
Synonyms Delta7-sterol reductase; Sterol reductase SR-2; 7-DHC reductase; 7-dehydrocholesterol reductase; D7SR; DHCR7
Gene Name DHCR7
UniProt ID
DHCR7_HUMAN
INTEDE ID
DME0591
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1717
EC Number EC: 1.3.1.21
Oxidoreductase
CH-CH donor oxidoreductase
NAD/NADP acceptor oxidoreductase
EC: 1.3.1.21
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAAKSQPNIPKAKSLDGVTNDRTASQGQWGRAWEVDWFSLASVIFLLLFAPFIVYYFIMA
CDQYSCALTGPVVDIVTGHARLSDIWAKTPPITRKAAQLYTLWVTFQVLLYTSLPDFCHK
FLPGYVGGIQEGAVTPAGVVNKYQINGLQAWLLTHLLWFANAHLLSWFSPTIIFDNWIPL
LWCANILGYAVSTFAMVKGYFFPTSARDCKFTGNFFYNYMMGIEFNPRIGKWFDFKLFFN
GRPGIVAWTLINLSFAAKQRELHSHVTNAMVLVNVLQAIYVIDFFWNETWYLKTIDICHD
HFGWYLGWGDCVWLPYLYTLQGLYLVYHPVQLSTPHAVGVLLLGLVGYYIFRVANHQKDL
FRRTDGRCLIWGRKPKVIECSYTSADGQRHHSKLLVSGFWGVARHFNYVGDLMGSLAYCL
ACGGGHLLPYFYIIYMAILLTHRCLRDEHRCASKYGRDWERYTAAVPYRLLPGIF
Function This enzyme reduces C7-C8 double bond of 7-dehydrocholesterol (7-DHC) to produce cholesterol.
KEGG Pathway
Metabolic pathways (hsa01100 )
Steroid biosynthesis (hsa00100 )
Reactome Pathway
Cholesterol biosynthesis via desmosterol (R-HSA-6807047 )
Cholesterol biosynthesis via lathosterol (R-HSA-6807062 )
Activation of gene expression by SREBF (SREBP) (R-HSA-2426168 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
desmosterol DMV8SUM Discovery agent N.A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.30E-15 -6.11E-01 -8.87E-01
Alopecia ED70 Skin from scalp 6.73E-01 1.34E-02 3.31E-02
Alzheimer's disease 8A20 Entorhinal cortex 2.14E-02 1.61E-01 4.84E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.81E-01 1.05E-01 3.29E-01
Aortic stenosis BB70 Calcified aortic valve 1.48E-01 -2.14E-01 -4.94E-01
Apnea 7A40 Hyperplastic tonsil 5.16E-01 -2.08E-01 -8.72E-01
Arthropathy FA00-FA5Z Peripheral blood 1.81E-01 -8.17E-03 -3.72E-02
Asthma CA23 Nasal and bronchial airway 8.68E-04 1.01E-01 1.37E-01
Atopic dermatitis EA80 Skin 3.74E-02 -2.38E-01 -3.88E-01
Autism 6A02 Whole blood 9.21E-03 -7.73E-02 -4.44E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.96E-01 -3.07E-01 -9.14E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.07E-03 1.12E+00 1.58E+00
Bacterial infection of gingival 1C1H Gingival tissue 4.98E-11 -3.77E-01 -1.14E+00
Batten disease 5C56.1 Whole blood 8.95E-01 -5.55E-02 -3.40E-01
Behcet's disease 4A62 Peripheral blood 3.95E-01 -1.31E-01 -4.75E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.93E-01 2.02E-02 9.76E-02
Bladder cancer 2C94 Bladder tissue 2.01E-03 4.69E-01 1.40E+00
Breast cancer 2C60-2C6Z Breast tissue 3.96E-32 6.85E-01 9.43E-01
Cardioembolic stroke 8B11.20 Whole blood 6.45E-06 2.76E-01 1.77E+00
Cervical cancer 2C77 Cervical tissue 1.71E-01 -1.52E-01 -4.09E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.88E-01 6.87E-02 2.82E-01
Chronic hepatitis C 1E51.1 Whole blood 4.58E-01 -2.44E-01 -5.96E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.87E-01 -1.39E-02 -2.86E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.59E-01 -5.51E-02 -1.43E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 4.64E-01 -9.16E-02 -1.51E-01
Colon cancer 2B90 Colon tissue 1.62E-45 9.10E-01 1.70E+00
Coronary artery disease BA80-BA8Z Peripheral blood 5.19E-02 3.31E-01 1.57E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.82E-01 -2.33E-01 -6.29E-01
Endometriosis GA10 Endometrium tissue 6.28E-01 -3.03E-02 -2.96E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.87E-01 8.73E-02 6.30E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.44E-01 -1.74E-01 -8.15E-01
Gastric cancer 2B72 Gastric tissue 6.56E-02 8.28E-01 2.60E+00
Glioblastopma 2A00.00 Nervous tissue 7.55E-29 -3.48E-01 -8.07E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 9.93E-01 -2.53E-01 -1.75E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.33E-02 5.56E-01 8.23E-01
Head and neck cancer 2D42 Head and neck tissue 1.12E-06 4.41E-01 8.34E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.06E-01 1.93E-01 4.06E-01
Huntington's disease 8A01.10 Whole blood 5.65E-01 -4.84E-02 -5.21E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.09E-02 -7.08E-01 -1.54E+00
Immunodeficiency 4A00-4A20 Peripheral blood 1.52E-01 -7.30E-02 -8.17E-01
Influenza 1E30 Whole blood 4.66E-02 -8.64E-01 -2.58E+00
Interstitial cystitis GC00.3 Bladder tissue 4.17E-02 -5.26E-01 -1.39E+00
Intracranial aneurysm 8B01.0 Intracranial artery 4.88E-01 -5.75E-02 -2.19E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 7.37E-01 3.88E-02 7.42E-02
Ischemic stroke 8B11 Peripheral blood 8.43E-01 -4.29E-03 -1.41E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 2.41E-01 1.14E-02 3.79E-02
Lateral sclerosis 8B60.4 Skin 7.38E-01 -4.27E-02 -1.09E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 9.81E-01 -1.43E-02 -2.37E-02
Liver cancer 2C12.0 Liver tissue 1.94E-01 -1.35E-02 -2.84E-02
Liver failure DB99.7-DB99.8 Liver tissue 9.55E-04 -1.75E+00 -2.89E+00
Lung cancer 2C25 Lung tissue 4.94E-10 1.60E-01 4.02E-01
Lupus erythematosus 4A40 Whole blood 3.86E-08 -1.48E-01 -4.13E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.27E-01 3.24E-02 1.55E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.14E-01 -7.45E-03 -2.15E-02
Melanoma 2C30 Skin 1.89E-05 -1.90E+00 -1.52E+00
Multiple myeloma 2A83.1 Peripheral blood 7.82E-01 -1.90E-01 -3.18E-01
Multiple myeloma 2A83.1 Bone marrow 1.89E-08 9.33E-01 6.79E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.14E-01 1.49E-01 7.57E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.42E-02 -4.55E-03 -9.89E-03
Myelofibrosis 2A20.2 Whole blood 7.14E-01 1.69E-02 1.37E-01
Myocardial infarction BA41-BA50 Peripheral blood 7.49E-03 9.71E-02 2.83E-01
Myopathy 8C70.6 Muscle tissue 3.04E-01 -8.35E-02 -6.41E-01
Neonatal sepsis KA60 Whole blood 9.97E-24 5.98E-01 2.64E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.63E-06 -1.07E+00 -2.86E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 7.67E-01 7.61E-02 1.24E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.30E-01 -2.20E-01 -1.18E+00
Olive pollen allergy CA08.00 Peripheral blood 9.03E-01 -4.80E-02 -1.13E-01
Oral cancer 2B6E Oral tissue 9.68E-04 3.85E-01 7.11E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.48E-01 3.55E-01 3.56E-01
Osteoporosis FB83.1 Bone marrow 2.83E-01 -2.25E-01 -8.66E-01
Ovarian cancer 2C73 Ovarian tissue 6.98E-01 -1.96E-01 -1.66E-01
Pancreatic cancer 2C10 Pancreas 4.96E-03 3.25E-01 7.55E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.37E-01 3.31E-02 7.80E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.25E-02 2.15E-01 1.47E+00
Pituitary cancer 2D12 Pituitary tissue 1.52E-02 6.69E-01 1.33E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.69E-01 2.97E-01 5.47E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.59E-01 1.10E-01 5.89E-01
Polycythemia vera 2A20.4 Whole blood 2.23E-01 -1.88E-02 -1.59E-01
Pompe disease 5C51.3 Biceps muscle 7.98E-01 -6.11E-02 -3.02E-01
Preterm birth KA21.4Z Myometrium 7.61E-01 -2.05E-01 -8.50E-01
Prostate cancer 2C82 Prostate 3.29E-02 -6.15E-01 -5.33E-01
Psoriasis EA90 Skin 8.22E-07 -4.43E-01 -7.49E-01
Rectal cancer 2B92 Rectal colon tissue 8.08E-03 7.64E-01 1.81E+00
Renal cancer 2C90-2C91 Kidney 2.04E-02 -2.69E-01 -1.17E+00
Retinoblastoma 2D02.2 Uvea 5.27E-06 -8.59E-01 -2.11E+00
Rheumatoid arthritis FA20 Synovial tissue 2.13E-04 4.64E-01 1.26E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.77E-02 -1.86E-01 -8.36E-01
Schizophrenia 6A20 Prefrontal cortex 2.49E-01 -6.54E-02 -1.32E-01
Schizophrenia 6A20 Superior temporal cortex 2.08E-01 -6.05E-02 -1.73E-01
Scleroderma 4A42.Z Whole blood 6.55E-06 -2.55E-01 -2.65E+00
Seizure 8A60-8A6Z Whole blood 9.41E-01 3.96E-02 1.34E-01
Sensitive skin EK0Z Skin 8.40E-01 -6.13E-02 -2.84E-01
Sepsis with septic shock 1G41 Whole blood 1.82E-104 6.56E-01 3.47E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.07E-01 -2.35E-01 -7.44E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.39E-01 7.92E-02 2.79E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 3.36E-01 3.47E-01 1.40E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.38E-01 2.77E-01 7.84E-01
Skin cancer 2C30-2C3Z Skin 3.11E-69 -1.75E+00 -2.28E+00
Thrombocythemia 3B63 Whole blood 9.08E-01 -8.55E-03 -6.66E-02
Thrombocytopenia 3B64 Whole blood 4.43E-01 6.28E-01 7.45E-01
Thyroid cancer 2D10 Thyroid 7.65E-11 1.95E-01 5.67E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.12E-02 -3.41E-01 -1.31E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.84E-01 1.57E-01 3.63E-01
Type 2 diabetes 5A11 Liver tissue 1.14E-01 2.27E-01 6.36E-01
Ureter cancer 2C92 Urothelium 4.36E-01 -4.14E-02 -2.61E-01
Uterine cancer 2C78 Endometrium tissue 8.86E-04 2.38E-01 2.98E-01
Vitiligo ED63.0 Skin 6.76E-01 2.05E-01 4.60E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Inhibitors of 7-dehydrocholesterol reductase: screening of a collection of pharmacologically active compounds in Neuro2a cells. Chem Res Toxicol. 2016 May 16;29(5):892-900.