Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DELB4KP)

• DME Name: Epoxide hydrolase 1 (EPHX1)
• Synonyms: Epoxide hydratase; Microsomal epoxide hydrolase; mEH; EPHX; EPHX1; EPOX
• Gene Name: EPHX1
• UniProt ID: HYEP_HUMAN
• INTEDE ID: DME0623
• Gene ID: 2052
• EC Number:
  EC: 3.3.2.9
  Hydrolases
  Ether hydrolase
  Ether hydrolase
  EC: 3.3.2.9
• Lineage:
  Species: Homo sapiens
  Kingdom: Metazoa
  Phylum: Chordata
  Class: Mammalia
  Order: Primates
  Family: Hominidae
  Genus: Homo
  Species: Homo sapiens
• Sequence:
  MWLEILLTSVLGFAIYWFISRDKEETLPLEDGWWGPGTRSAAREDDSIRPFKVETSDEEI
  HDLHQRIDKFRFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRYPHFKTKI
  EGLDIHFIHVKPPQLPAGHTPKPLLMVHGWPGSFYEFYKIIPLLTDPKNHGLSDEHVFEV
  ICPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLICTNMAQLVP
  SHVKGLHLNMALVLSNFSTLTLLLGQRFGRFLGLTERDVELLYPVKEKVFYSLMRESGYM
  HIQCTKPDTVGSALNDSPVGLAAYILEKFSTWTNTEFRYLEDGGLERKFSLDDLLTNVML
  YWTTGTIISSQRFYKENLGQGWMTQKHERMKVYVPTGFSAFPFELLHTPEKWVRFKYPKL
  ISYSYMVRGGHFAAFEEPELLAQDIRKFLSVLERQ
• Function: This enzyme catalyzes the hydrolysis of arene and aliphatic epoxides to less reactive and more water soluble dihydrodiols by the trans addition of water.
• KEGG Pathway:
  Bile secretion (hsa04976)
  Chemical carcinogenesis (hsa05204)
  Metabolism of xenobiotics by cytochrome P450 (hsa00980)
• Reactome Pathway: Phase I - Functionalization of compounds (R-HSA-211945)

Molecular Interaction Atlas (MIA) of This DME

1 Approved Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Carbamazepine	DMZOLBI	Epilepsy	8A60-8A68	Approved	[1]

Molecular Expression Atlas (MEA) of This DME

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	7.24E-04	-2.80E-01	-4.35E-01
Alzheimer's disease	8A20	Entorhinal cortex	2.52E-05	2.64E-01	3.89E-01
Asthma	CA23	Nasal and bronchial airway	2.54E-03	3.90E-01	4.08E-01
Behcet's disease	4A62	Peripheral blood	7.65E-01	1.49E-01	4.16E-01
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	3.17E-01	1.07E-01	1.75E-01
Bladder cancer	2C94	Bladder tissue	9.44E-04	-8.78E-01	-1.48E+00
Breast cancer	2C60-2C6Z	Breast tissue	1.19E-02	-7.75E-01	-3.86E-01
Colon cancer	2B90	Colon tissue	1.11E-75	-1.27E+00	-2.17E+00
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	4.55E-02	1.39E-01	6.13E-01
Familial hypercholesterolemia	5C80.00	Peripheral blood	3.07E-01	5.29E-02	2.37E-01
Gastric cancer	2B72	Gastric tissue	4.56E-02	-1.40E+00	-1.82E+00
Glioblastopma	2A00.00	Nervous tissue	1.82E-37	-1.18E+00	-8.47E-01
Head and neck cancer	2D42	Head and neck tissue	4.59E-20	-1.76E+00	-1.08E+00
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	5.84E-01	1.20E-01	1.53E-01
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	1.77E-06	1.42E+00	7.87E+00
Interstitial cystitis	GC00.3	Bladder tissue	2.10E-02	-1.02E+00	-1.29E+00
Ischemic stroke	8B11	Peripheral blood	9.07E-02	-1.05E-01	-3.50E-01
Liver cancer	2C12.0	Liver tissue	5.39E-01	-1.47E-01	-7.91E-02
Liver failure	DB99.7-DB99.8	Liver tissue	8.17E-01	4.00E-01	4.12E-01
Lung cancer	2C25	Lung tissue	1.10E-60	-1.56E+00	-1.79E+00
Lupus erythematosus	4A40	Whole blood	8.89E-01	5.46E-03	7.25E-03
Major depressive disorder	6A70-6A7Z	Hippocampus	7.27E-01	2.07E-01	3.36E-01
Multiple myeloma	2A83.1	Bone marrow	5.10E-02	-3.76E-01	-6.53E-01
Multiple myeloma	2A83.1	Peripheral blood	5.71E-01	-4.90E-02	-1.59E-01
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	4.50E-02	3.74E-01	1.20E+00
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	2.36E-01	2.11E-02	8.22E-02
Myocardial infarction	BA41-BA50	Peripheral blood	1.04E-01	4.95E-02	1.06E-01
Neuroectodermal tumour	2A00.11	Brain stem tissue	1.78E-12	-4.13E+00	-8.82E+00
Non-alcoholic fatty liver disease	DB92	Liver tissue	7.03E-01	2.79E-01	3.73E-01
Obesity related type 2 diabetes	5A11	Omental adipose tissue	3.70E-01	2.05E-01	5.67E-01
Olive pollen allergy	CA08.00	Peripheral blood	9.99E-01	-3.91E-02	-1.65E-01
Oral cancer	2B6E	Oral tissue	7.98E-02	-1.36E+00	-7.91E-01
Ovarian cancer	2C73	Ovarian tissue	1.35E-04	-1.58E+00	-2.07E+00
Pancreatic cancer	2C10	Pancreas	3.02E-01	5.30E-01	4.25E-01
Parkinson's disease	8A00.0	Substantia nigra tissue	5.47E-02	4.25E-01	9.04E-01
Pituitary cancer	2D12	Pituitary tissue	1.40E-04	-8.32E-01	-1.52E+00
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	7.03E-01	-7.97E-02	-3.54E-01
Pompe disease	5C51.3	Biceps muscle	3.40E-02	4.48E-01	2.30E+00
Prostate cancer	2C82	Prostate	5.28E-06	-7.73E-01	-1.18E+00
Psoriasis	EA90	Skin	1.31E-14	-9.39E-01	-1.46E+00
Rectal cancer	2B92	Rectal colon tissue	4.06E-07	-1.56E+00	-5.87E+00
Renal cancer	2C90-2C91	Kidney	5.50E-05	-1.62E+00	-1.97E+00
Retinoblastoma	2D02.2	Uvea	9.79E-05	-2.09E+00	-1.52E+01
Schizophrenia	6A20	Prefrontal cortex	7.96E-01	3.63E-02	4.11E-02
Schizophrenia	6A20	Superior temporal cortex	8.81E-01	1.77E-01	2.89E-01
Scleroderma	4A42.Z	Whole blood	6.73E-03	-4.74E-01	-1.39E+00
Seizure	8A60-8A6Z	Whole blood	5.72E-01	-1.38E-02	-6.05E-02
Sepsis with septic shock	1G41	Whole blood	1.47E-01	2.89E-02	7.66E-02
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	6.35E-01	4.33E-02	1.88E-01
Simpson golabi behmel syndrome	LD2C	Adipose tissue	9.61E-01	3.54E-02	4.18E-02
Sjogren's syndrome	4A43.2	Salivary gland tissue	4.31E-03	7.47E-01	3.45E+00
Skin cancer	2C30-2C3Z	Skin	3.53E-48	-1.44E+00	-2.05E+00
Thrombocythemia	3B63	Whole blood	9.23E-01	1.42E-02	1.33E-01
Thrombocytopenia	3B64	Whole blood	4.57E-01	1.22E+00	6.42E-01
Thyroid cancer	2D10	Thyroid	4.89E-06	-6.06E-01	-4.95E-01
Tibial muscular dystrophy	8C75	Muscle tissue	5.04E-01	1.58E-02	2.42E-02
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	2.98E-01	4.96E-01	5.27E-01
Type 2 diabetes	5A11	Liver tissue	5.88E-01	-2.97E-01	-5.05E-01
Ureter cancer	2C92	Urothelium	7.21E-01	3.53E-02	1.11E-01
Uterine cancer	2C78	Endometrium tissue	7.24E-10	-1.22E+00	-8.13E-01
Vitiligo	ED63.0	Skin	6.58E-01	-8.59E-02	-2.90E-01

References

• [1] Haplotype structures of EPHX1 and their effects on the metabolism of carbamazepine-10,11-epoxide in Japanese epileptic patients. Eur J Clin Pharmacol. 2005 Mar;61(1):25-34.