Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEM1HNL)

DME Name Alcohol dehydrogenase class-I gamma (ADH1C)
Synonyms Alcohol dehydrogenase 1C; Alcohol dehydrogenase subunit gamma; ADH1C; ADH3
Gene Name ADH1C
UniProt ID
ADH1G_HUMAN
INTEDE ID
DME0129
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
126
EC Number EC: 1.1.1.1
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDEHVVSGNLVT
PLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDLGNP
RGTLQDGTRRFTCSGKPIHHFVGVSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTG
YGSAVKVAKVTPGSTCAVFGLGGVGLSVVMGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQ
NLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNILPFEKINEGF
DLLRSGKSIRTVLTF
Function This enzyme metabolizes a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products.
KEGG Pathway
Chemical carcinogenesis (hsa05204 )
Drug metabolism - cytochrome P450 (hsa00982 )
Fatty acid degradation (hsa00071 )
Glycolysis / Gluconeogenesis (hsa00010 )
Metabolic pathways (hsa01100 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Retinol metabolism (hsa00830 )
Tyrosine metabolism (hsa00350 )
Reactome Pathway
RA biosynthesis pathway (R-HSA-5365859 )
Ethanol oxidation (R-HSA-71384 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Ethanol DMDRQZU Chronic pain MG30 Approved [1]
7 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
acetaldehyde DMJFKG4 Discovery agent N.A. Investigative [2]
BRN-2330710 DM87VP6 N. A. N. A. Investigative [2]
Hydroxymethylpyrene DMPGAR2 N. A. N. A. Investigative [2]
Octanal DMTN0OK N. A. N. A. Investigative [2]
octanol DMBGHPE Discovery agent N.A. Investigative [2]
Pyrene-1-aldehyde DMEF6IP N. A. N. A. Investigative [2]
Pyrenemethanol DMGJ0RM N. A. N. A. Investigative [2]
⏷ Show the Full List of 7 Investigative Drug(s)
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
acetaldehyde Discovery agent [N.A.] Investigative Km = 0.34 microM [2]
octanol Discovery agent [N.A.] Investigative Km = 0.39 microM [2]
Ethanol Chronic pain [MG30] Approved Km = 0.77 microM [2]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.62E-01 4.04E-02 1.65E-01
Alopecia ED70 Skin from scalp 7.99E-02 2.32E-01 3.97E-01
Alzheimer's disease 8A20 Entorhinal cortex 6.91E-01 4.25E-03 2.95E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 3.57E-01 5.27E-02 4.12E-01
Aortic stenosis BB70 Calcified aortic valve 1.26E-01 -3.04E-01 -4.52E-01
Apnea 7A40 Hyperplastic tonsil 3.19E-01 8.74E-02 6.49E-01
Arthropathy FA00-FA5Z Peripheral blood 9.34E-02 2.32E-02 1.90E-01
Asthma CA23 Nasal and bronchial airway 1.56E-05 1.06E+00 1.12E+00
Atopic dermatitis EA80 Skin 4.29E-02 -1.82E-01 -7.07E-01
Autism 6A02 Whole blood 5.18E-01 -1.79E-02 -9.75E-02
Autoimmune uveitis 9A96 Peripheral monocyte 4.90E-01 -1.90E-01 -1.28E+00
Autosomal dominant monocytopenia 4B04 Whole blood 5.46E-02 1.56E-01 1.08E+00
Bacterial infection of gingival 1C1H Gingival tissue 1.71E-01 -1.65E-02 -7.03E-02
Batten disease 5C56.1 Whole blood 9.16E-01 -4.12E-02 -3.63E-01
Behcet's disease 4A62 Peripheral blood 8.75E-01 6.93E-02 3.16E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.08E-01 -1.50E-02 -1.22E-01
Bladder cancer 2C94 Bladder tissue 1.79E-05 -1.73E+00 -3.89E+00
Breast cancer 2C60-2C6Z Breast tissue 8.83E-81 -3.23E+00 -2.09E+00
Cardioembolic stroke 8B11.20 Whole blood 1.02E-01 -8.00E-02 -4.49E-01
Cervical cancer 2C77 Cervical tissue 6.71E-01 -1.01E-01 -6.68E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.30E-01 -5.99E-02 -2.77E-01
Chronic hepatitis C 1E51.1 Whole blood 3.58E-01 5.71E-02 4.15E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 6.20E-01 2.32E-02 6.34E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.38E-05 -6.24E-01 -9.10E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.75E-03 -2.00E+00 -1.93E+00
Colon cancer 2B90 Colon tissue 3.84E-259 -4.71E+00 -7.42E+00
Coronary artery disease BA80-BA8Z Peripheral blood 3.12E-01 -2.26E-01 -7.96E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.95E-01 -1.07E-01 -6.65E-01
Endometriosis GA10 Endometrium tissue 2.30E-02 1.49E-01 3.14E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.67E-01 1.11E-01 7.83E-01
Familial hypercholesterolemia 5C80.00 Whole blood 8.40E-04 -2.59E-01 -1.07E+00
Gastric cancer 2B72 Gastric tissue 6.19E-01 -1.92E+00 -6.22E-01
Glioblastopma 2A00.00 Nervous tissue 4.17E-01 7.05E-02 1.88E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.40E-01 9.37E-02 1.55E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 4.25E-02 -2.04E-01 -4.89E-01
Head and neck cancer 2D42 Head and neck tissue 4.13E-16 -1.81E+00 -6.05E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.51E-01 -2.23E-02 -1.17E-01
Huntington's disease 8A01.10 Whole blood 1.93E-01 3.99E-02 2.33E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.87E-01 -2.73E-01 -3.65E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.33E-01 4.89E-02 5.02E-01
Influenza 1E30 Whole blood 2.97E-01 1.06E-01 2.67E+00
Interstitial cystitis GC00.3 Bladder tissue 2.19E-01 -4.89E-01 -1.01E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.58E-01 2.17E-03 2.04E-03
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.30E-02 -1.15E-01 -6.26E-01
Ischemic stroke 8B11 Peripheral blood 9.20E-01 -1.95E-02 -1.26E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.25E-02 2.92E-02 1.57E-01
Lateral sclerosis 8B60.4 Skin 8.17E-01 4.44E-02 1.59E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 5.38E-01 7.97E-02 3.51E-01
Liver cancer 2C12.0 Liver tissue 1.31E-40 -2.08E+00 -3.45E+00
Liver failure DB99.7-DB99.8 Liver tissue 7.66E-05 -4.89E+00 -1.17E+01
Lung cancer 2C25 Lung tissue 2.73E-10 -8.24E-01 -1.21E+00
Lupus erythematosus 4A40 Whole blood 5.93E-01 -1.38E-02 -3.98E-02
Major depressive disorder 6A70-6A7Z Hippocampus 2.21E-01 3.01E-02 2.41E-01
Major depressive disorder 6A70-6A7Z Whole blood 5.58E-03 1.03E-01 4.07E-01
Melanoma 2C30 Skin 1.34E-01 -2.35E-01 -3.04E-01
Multiple myeloma 2A83.1 Peripheral blood 4.31E-01 -1.70E-03 -1.23E-02
Multiple myeloma 2A83.1 Bone marrow 1.10E-02 -2.14E-01 -1.18E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.65E-01 9.86E-03 4.62E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.30E-02 1.63E-02 1.02E-01
Myelofibrosis 2A20.2 Whole blood 4.22E-02 8.09E-02 5.29E-01
Myocardial infarction BA41-BA50 Peripheral blood 2.71E-01 1.25E-01 2.46E-01
Myopathy 8C70.6 Muscle tissue 8.99E-01 -1.59E-01 -2.68E-01
Neonatal sepsis KA60 Whole blood 3.13E-01 -2.08E-02 -7.82E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.19E-01 -1.08E-01 -3.24E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 1.89E-01 5.13E-01 7.77E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.86E-01 -3.23E-01 -7.96E-01
Olive pollen allergy CA08.00 Peripheral blood 4.45E-01 6.49E-02 4.29E-01
Oral cancer 2B6E Oral tissue 7.95E-02 -3.51E-01 -4.95E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.60E-01 -1.97E+00 -1.17E+00
Osteoporosis FB83.1 Bone marrow 8.51E-01 -1.04E-02 -6.78E-02
Ovarian cancer 2C73 Ovarian tissue 6.35E-02 -9.16E-01 -1.12E+00
Pancreatic cancer 2C10 Pancreas 6.67E-01 2.16E-02 1.27E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 8.13E-01 4.91E-02 3.68E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.88E-03 3.13E-02 3.65E-01
Pituitary cancer 2D12 Pituitary tissue 4.31E-01 -2.47E-01 -6.75E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.77E-02 -4.09E-01 -8.87E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.43E-01 5.01E-02 1.10E-01
Polycythemia vera 2A20.4 Whole blood 1.52E-03 9.41E-02 6.82E-01
Pompe disease 5C51.3 Biceps muscle 3.82E-01 -3.56E-01 -5.24E-01
Preterm birth KA21.4Z Myometrium 9.39E-02 3.11E-01 1.12E+00
Prostate cancer 2C82 Prostate 7.09E-02 1.81E+00 9.75E-01
Psoriasis EA90 Skin 6.60E-09 -3.62E-01 -7.04E-01
Rectal cancer 2B92 Rectal colon tissue 1.08E-19 -3.56E+00 -1.15E+01
Renal cancer 2C90-2C91 Kidney 1.64E-04 -2.59E+00 -2.15E+00
Retinoblastoma 2D02.2 Uvea 2.72E-01 1.65E-02 2.26E-01
Rheumatoid arthritis FA20 Synovial tissue 1.99E-02 -2.18E+00 -1.60E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.22E-01 -9.15E-02 -1.81E-01
Schizophrenia 6A20 Prefrontal cortex 6.56E-02 5.46E-02 2.76E-01
Schizophrenia 6A20 Superior temporal cortex 7.54E-02 -2.49E-02 -2.44E-01
Scleroderma 4A42.Z Whole blood 1.82E-02 1.91E-01 9.79E-01
Seizure 8A60-8A6Z Whole blood 6.69E-01 2.21E-03 1.73E-02
Sensitive skin EK0Z Skin 4.22E-01 -1.52E-01 -8.33E-01
Sepsis with septic shock 1G41 Whole blood 3.30E-01 -1.14E-02 -3.90E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.15E-01 2.26E-01 5.40E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.10E-01 9.66E-02 7.75E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.77E-01 -1.69E-01 -4.53E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.77E-02 4.29E-01 1.02E+00
Skin cancer 2C30-2C3Z Skin 4.60E-28 -8.46E-01 -1.17E+00
Thrombocythemia 3B63 Whole blood 1.15E-01 1.45E-01 1.02E+00
Thrombocytopenia 3B64 Whole blood 5.09E-01 3.26E+00 1.80E+00
Thyroid cancer 2D10 Thyroid 2.17E-12 -4.63E-01 -1.13E+00
Tibial muscular dystrophy 8C75 Muscle tissue 7.93E-03 9.92E-01 1.29E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.73E-01 -7.14E-02 -4.17E-01
Type 2 diabetes 5A11 Liver tissue 2.79E-01 2.28E-01 6.08E-01
Ureter cancer 2C92 Urothelium 9.06E-01 7.74E-02 5.03E-01
Uterine cancer 2C78 Endometrium tissue 1.06E-01 -1.58E-01 -1.69E-01
Vitiligo ED63.0 Skin 1.08E-01 -7.28E-01 -1.09E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Natural alcohol exposure: is ethanol the main substrate for alcohol dehydrogenases in animals? Chem Biol Interact. 2011 May 30;191(1-3):14-25.
2 Oxidation of alcohols and reduction of aldehydes derived from methyl- and dimethylpyrenes by cDNA-expressed human alcohol dehydrogenases. Toxicology. 2008 Mar 12;245(1-2):65-75.