Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEMJ7R2)

DME Name Amidophosphoribosyltransferase (GPAT)
Synonyms Glutamine phosphoribosylpyrophosphate amidotransferase; ATase; GPAT; PPAT
Gene Name PPAT
UniProt ID
PUR1_HUMAN
INTEDE ID
DME0136
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
5471
EC Number EC: 2.4.2.14
Transferase
Glycosyltransferases
Pentosyltransferase
EC: 2.4.2.14
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MELEELGIREECGVFGCIASGEWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSSVPT
FKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVA
HNGELVNAARLRKKLLRHGIGLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEA
PTAYSLLIMHRDVIYAVRDPYGNRPLCIGRLIPVSDINDKEKKTSETEGWVVSSESCSFL
SIGARYYREVLPGEIVEISRHNVQTLDIISRSEGNPVAFCIFEYVYFARPDSMFEDQMVY
TVRYRCGQQLAIEAPVDADLVSTVPESATPAALAYAGKCGLPYVEVLCKNRYVGRTFIQP
NMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASP
PIKYPCFMGINIPTKEELIANKPEFDHLAEYLGANSVVYLSVEGLVSSVQEGIKFKKQKE
KKHDIMIQENGNGLECFEKSGHCTACLTGKYPVELEW
Function This enzyme is responsible for catalyzing the conversion of 5-phosphoribosyl-1-pyrophosphate (PRPP) into 5-phosphoribosyl-1-amine (PRA), using the amine group from a glutamine side-chain.
KEGG Pathway
Alanine, aspartate and glutamate metabolism (hsa00250 )
Metabolic pathways (hsa01100 )
Purine metabolism (hsa00230 )
Reactome Pathway
Purine ribonucleoside monophosphate biosynthesis (R-HSA-73817 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Fluorouracil DMUM7HZ Adenocarcinoma 2D40 Approved [7]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.77E-05 1.49E-01 2.59E-01
Alopecia ED70 Skin from scalp 7.83E-01 -3.98E-02 -9.25E-02
Alzheimer's disease 8A20 Entorhinal cortex 2.58E-01 7.50E-02 3.10E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.02E-01 -2.94E-02 -1.39E-01
Aortic stenosis BB70 Calcified aortic valve 2.88E-01 1.01E-01 4.59E-01
Apnea 7A40 Hyperplastic tonsil 2.87E-01 -1.68E-01 -2.34E-01
Arthropathy FA00-FA5Z Peripheral blood 1.08E-01 -1.93E-01 -5.63E-01
Asthma CA23 Nasal and bronchial airway 3.35E-01 1.00E-01 1.73E-01
Atopic dermatitis EA80 Skin 6.43E-01 1.91E-01 6.56E-01
Autism 6A02 Whole blood 2.41E-01 8.02E-02 2.30E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.73E-01 4.84E-02 3.79E-01
Autosomal dominant monocytopenia 4B04 Whole blood 4.61E-01 2.23E-01 1.66E+00
Bacterial infection of gingival 1C1H Gingival tissue 9.11E-02 -7.81E-02 -2.31E-01
Batten disease 5C56.1 Whole blood 8.78E-01 -1.73E-01 -2.58E-01
Behcet's disease 4A62 Peripheral blood 3.02E-01 -2.56E-01 -7.86E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.16E-02 7.16E-02 3.19E-01
Bladder cancer 2C94 Bladder tissue 8.47E-06 4.72E-01 2.60E+00
Breast cancer 2C60-2C6Z Breast tissue 9.35E-43 8.76E-01 1.21E+00
Cardioembolic stroke 8B11.20 Whole blood 9.32E-01 6.38E-02 1.75E-01
Cervical cancer 2C77 Cervical tissue 9.56E-03 2.59E-01 5.25E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.27E-01 4.64E-02 7.06E-02
Chronic hepatitis C 1E51.1 Whole blood 5.78E-01 8.68E-02 2.43E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.10E-01 -2.20E-02 -1.09E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.10E-03 -1.78E-01 -5.61E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.68E-01 1.49E-01 6.55E-01
Colon cancer 2B90 Colon tissue 9.75E-89 1.30E+00 2.97E+00
Coronary artery disease BA80-BA8Z Peripheral blood 8.43E-02 1.42E-01 7.89E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.78E-01 3.38E-02 6.86E-02
Endometriosis GA10 Endometrium tissue 4.40E-01 -8.79E-02 -1.51E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.33E-01 7.65E-02 2.02E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.53E-03 -2.71E-01 -1.17E+00
Gastric cancer 2B72 Gastric tissue 6.82E-02 1.17E+00 1.86E+00
Glioblastopma 2A00.00 Nervous tissue 1.51E-48 4.55E-01 1.02E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.52E-01 1.90E-01 1.16E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 4.67E-04 5.84E-01 7.19E-01
Head and neck cancer 2D42 Head and neck tissue 8.06E-31 5.81E-01 2.16E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.45E-01 -1.01E-01 -4.07E-01
Huntington's disease 8A01.10 Whole blood 8.73E-01 1.09E-02 3.71E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.67E-01 2.36E-01 2.45E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.03E-01 2.99E-01 1.57E+00
Influenza 1E30 Whole blood 1.61E-01 -2.27E-01 -4.74E-01
Interstitial cystitis GC00.3 Bladder tissue 4.75E-01 7.29E-02 3.23E-01
Intracranial aneurysm 8B01.0 Intracranial artery 3.47E-01 3.77E-01 6.32E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.59E-01 9.74E-02 2.93E-01
Ischemic stroke 8B11 Peripheral blood 6.20E-02 -2.76E-01 -8.42E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.67E-01 -7.33E-02 -1.52E-01
Lateral sclerosis 8B60.4 Skin 5.23E-01 1.16E-01 3.48E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 8.41E-01 -2.24E-01 -4.66E-01
Liver cancer 2C12.0 Liver tissue 3.55E-06 4.61E-01 8.19E-01
Liver failure DB99.7-DB99.8 Liver tissue 5.06E-03 -7.45E-01 -2.06E+00
Lung cancer 2C25 Lung tissue 2.78E-138 1.47E+00 3.49E+00
Lupus erythematosus 4A40 Whole blood 3.01E-01 3.25E-01 3.27E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.15E-01 2.10E-02 9.46E-02
Major depressive disorder 6A70-6A7Z Whole blood 2.71E-01 -2.34E-01 -3.84E-01
Melanoma 2C30 Skin 4.60E-02 3.21E-01 3.13E-01
Multiple myeloma 2A83.1 Peripheral blood 5.13E-01 -2.89E-01 -3.28E-01
Multiple myeloma 2A83.1 Bone marrow 9.57E-05 6.19E-01 2.48E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.76E-02 -6.60E-01 -1.40E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.65E-03 7.11E-01 9.84E-01
Myelofibrosis 2A20.2 Whole blood 1.67E-01 5.10E-02 2.64E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.09E-02 -7.01E-01 -6.29E-01
Myopathy 8C70.6 Muscle tissue 8.11E-01 9.13E-02 1.51E-01
Neonatal sepsis KA60 Whole blood 1.23E-12 -5.72E-01 -1.27E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.15E-08 1.78E+00 3.89E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 8.19E-01 2.18E-01 5.94E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.60E-01 -5.59E-01 -6.01E-01
Olive pollen allergy CA08.00 Peripheral blood 4.02E-01 -5.72E-01 -6.47E-01
Oral cancer 2B6E Oral tissue 1.84E-04 4.91E-01 7.22E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.36E-01 2.34E-01 6.11E-01
Osteoporosis FB83.1 Bone marrow 4.98E-01 1.31E-01 2.46E-01
Ovarian cancer 2C73 Ovarian tissue 4.24E-03 8.10E-01 1.32E+00
Pancreatic cancer 2C10 Pancreas 5.09E-02 -1.10E-01 -2.81E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 7.78E-01 -3.44E-02 -1.21E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.86E-01 -1.03E-01 -3.01E-01
Pituitary cancer 2D12 Pituitary tissue 4.61E-01 1.40E-01 2.29E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 9.91E-01 1.37E-01 2.99E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.54E-01 -6.03E-02 -3.33E-01
Polycythemia vera 2A20.4 Whole blood 4.67E-01 -4.53E-02 -3.56E-01
Pompe disease 5C51.3 Biceps muscle 1.31E-04 -4.76E-01 -1.98E+00
Preterm birth KA21.4Z Myometrium 7.31E-01 1.21E-01 2.50E-01
Prostate cancer 2C82 Prostate 3.99E-09 1.99E+00 2.38E+00
Psoriasis EA90 Skin 3.00E-15 3.76E-01 6.90E-01
Rectal cancer 2B92 Rectal colon tissue 2.35E-04 1.00E+00 3.01E+00
Renal cancer 2C90-2C91 Kidney 4.14E-03 6.23E-01 1.24E+00
Retinoblastoma 2D02.2 Uvea 7.52E-05 9.50E-01 3.53E+00
Rheumatoid arthritis FA20 Synovial tissue 9.25E-02 -3.60E-01 -9.68E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.09E-01 5.48E-02 2.94E-01
Schizophrenia 6A20 Prefrontal cortex 6.35E-01 -8.06E-02 -2.52E-01
Schizophrenia 6A20 Superior temporal cortex 5.98E-01 2.18E-02 1.74E-01
Scleroderma 4A42.Z Whole blood 1.49E-03 -4.43E-01 -1.94E+00
Seizure 8A60-8A6Z Whole blood 8.64E-01 3.95E-02 8.82E-02
Sensitive skin EK0Z Skin 7.56E-01 5.62E-02 3.46E-01
Sepsis with septic shock 1G41 Whole blood 8.62E-25 -5.69E-01 -1.23E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.72E-01 1.17E-03 2.64E-03
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.26E-02 -1.72E-01 -5.27E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.92E-01 2.17E-01 2.18E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.70E-01 3.52E-01 1.19E+00
Skin cancer 2C30-2C3Z Skin 2.20E-68 1.49E+00 2.13E+00
Thrombocythemia 3B63 Whole blood 2.26E-01 -4.02E-02 -2.25E-01
Thrombocytopenia 3B64 Whole blood 6.14E-01 2.81E-02 2.16E-02
Thyroid cancer 2D10 Thyroid 4.64E-01 -1.80E-01 -6.34E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.77E-01 1.69E-01 5.35E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.12E-01 -2.25E-01 -1.60E+00
Type 2 diabetes 5A11 Liver tissue 2.10E-01 2.31E-01 6.39E-01
Ureter cancer 2C92 Urothelium 5.82E-01 4.11E-03 1.80E-02
Uterine cancer 2C78 Endometrium tissue 1.12E-24 7.73E-01 1.29E+00
Vitiligo ED63.0 Skin 9.33E-01 -4.12E-02 -1.72E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Amidophosphoribosyltransferase (PPAT) DTT Info
DME DTT Type Successful
2 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Azathioprine DMMZSXQ Lupus nephritis 4A40.0Y Approved [1]
Mercaptopurine DMTM2IK Acute lymphoblastic leukaemia 2A85 Approved [2]
4 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
6-Chloropurine Riboside, 5'-Monophosphate DMWB43U Discovery agent N.A. Investigative [3]
Mycophenolic bis(sulfonamide) DMUQP3J Discovery agent N.A. Investigative [4]
Mycophenolic hydroxamic acid DM4YRAH Discovery agent N.A. Investigative [5]
Tiazofurin adenine dinucleotide DMEFVPH Discovery agent N.A. Investigative [6]

References

1 IMPDH activity in thiopurine-treated patients with inflammatory bowel disease - relation to TPMT activity and metabolite concentrations. Br J Clin Pharmacol. 2008 Jan;65(1):69-77.
2 6-mercaptopurine (6-MP) induces p53-mediated apoptosis of neural progenitor cells in the developing fetal rodent brain. Neurotoxicol Teratol. 2009 Jul-Aug;31(4):198-202.
3 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
4 Bis(sulfonamide) isosters of mycophenolic adenine dinucleotide analogues: inhibition of inosine monophosphate dehydrogenase. Bioorg Med Chem. 2008 Aug 1;16(15):7462-9.
5 Structure-activity relationships for inhibition of inosine monophosphate dehydrogenase and differentiation induction of K562 cells among the mycoph... Bioorg Med Chem. 2010 Nov 15;18(22):8106-11.
6 Dual inhibitors of inosine monophosphate dehydrogenase and histone deacetylases for cancer treatment. J Med Chem. 2007 Dec 27;50(26):6685-91.
7 PharmGKB: A worldwide resource for pharmacogenomic information. Wiley Interdiscip Rev Syst Biol Med. 2018 Jul;10(4):e1417. (ID: PA150653776)