Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEMWO83)

DME Name Putrescine acetyltransferase (SSAT1)
Synonyms Diamine acetyltransferase 1; Polyamine N-acetyltransferase 1; Spermidine/spermine N(1)-acetyltransferase 1; SAT1; SSAT; SSAT-1; SSAT1
Gene Name SAT1
UniProt ID
SAT1_HUMAN
INTEDE ID
DME0216
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
6303
EC Number EC: 2.3.1.57
Transferase
Acyltransferase
Acyltransferase
EC: 2.3.1.57
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVP
KEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRC
RCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
Function
This enzyme catalyzes the acetylation of polyamines. Substrate specificity: norspermidine = spermidine >> spermine > N(1)- acetylspermine > putrescine. This highly regulated enzyme allows a fine attenuation of the intracellular concentration of polyamines.
KEGG Pathway
Arginine and proline metabolism (hsa00330 )
Ferroptosis (hsa04216 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Interconversion of polyamines (R-HSA-351200 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Spermidine DMVJNFI Plaque psoriasis EA90.0 Phase 3 [1]
1 Discontinued Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
SPERMINE DMD4BFY N. A. N. A. Terminated [2]
3 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Ethylene diamine DMBULX4 Tuberculosis 1B10-1B1Z Investigative [2]
N1-(2-aminoethyl)ethane-1,2-diamine DM6HM5S Discovery agent N.A. Investigative [2]
Propandiamine DMQ9USH N. A. N. A. Investigative [2]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
Ethylene diamine Tuberculosis [1B10-1B1Z] Investigative Km = 0.196 microM [2]
N1-(2-aminoethyl)ethane-1,2-diamine Discovery agent [N.A.] Investigative Km = 0.194 microM [2]
SPERMINE N. A. Terminated Km = 0.0057 microM [2]
Spermidine Plaque psoriasis [EA90.0] Phase 3 Km = 0.022 microM [2]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.03E-01 -2.01E-02 -2.88E-02
Alopecia ED70 Skin from scalp 1.77E-01 1.21E-01 4.97E-01
Alzheimer's disease 8A20 Entorhinal cortex 3.92E-09 3.10E-01 6.82E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.22E-01 -7.40E-04 -5.71E-03
Aortic stenosis BB70 Calcified aortic valve 9.25E-01 -2.42E-01 -1.72E-01
Apnea 7A40 Hyperplastic tonsil 1.78E-02 1.37E+00 1.83E+00
Arthropathy FA00-FA5Z Peripheral blood 8.81E-03 1.92E-01 8.54E-01
Asthma CA23 Nasal and bronchial airway 2.12E-04 1.79E-01 5.45E-01
Atopic dermatitis EA80 Skin 6.71E-10 4.51E-01 4.19E+00
Autism 6A02 Whole blood 6.13E-02 3.32E-01 6.05E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.19E-01 6.68E-02 2.78E-01
Autosomal dominant monocytopenia 4B04 Whole blood 4.86E-01 2.21E-02 8.80E-02
Bacterial infection of gingival 1C1H Gingival tissue 1.89E-04 1.26E-01 4.13E-01
Batten disease 5C56.1 Whole blood 5.89E-01 1.09E-01 3.08E-01
Behcet's disease 4A62 Peripheral blood 9.49E-01 4.58E-02 1.40E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.03E-01 1.08E-01 4.68E-01
Bladder cancer 2C94 Bladder tissue 6.33E-04 9.64E-01 2.83E+00
Breast cancer 2C60-2C6Z Breast tissue 1.55E-45 6.17E-01 1.19E+00
Cardioembolic stroke 8B11.20 Whole blood 1.20E-02 -1.72E-01 -1.04E+00
Cervical cancer 2C77 Cervical tissue 4.60E-01 2.14E-01 3.33E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.21E-01 1.15E-02 1.89E-02
Chronic hepatitis C 1E51.1 Whole blood 3.47E-01 8.33E-02 1.35E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.93E-01 8.52E-02 2.73E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.64E-01 9.27E-02 2.72E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.31E-01 1.47E-01 2.07E-01
Colon cancer 2B90 Colon tissue 2.69E-04 8.55E-02 3.21E-01
Coronary artery disease BA80-BA8Z Peripheral blood 9.79E-01 -2.32E-01 -4.38E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.40E-01 -3.40E-01 -6.59E-01
Endometriosis GA10 Endometrium tissue 2.66E-01 -6.37E-01 -6.05E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.73E-01 -9.31E-02 -2.48E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.65E-08 8.10E-01 1.42E+00
Gastric cancer 2B72 Gastric tissue 5.79E-01 1.95E-01 3.01E-01
Glioblastopma 2A00.00 Nervous tissue 3.82E-73 8.57E-01 1.48E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 8.27E-01 -2.90E-02 -4.36E-02
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.90E-01 -1.42E-01 -3.59E-01
Head and neck cancer 2D42 Head and neck tissue 8.36E-01 1.33E-01 2.25E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.67E-02 4.12E-01 9.21E-01
Huntington's disease 8A01.10 Whole blood 3.85E-01 -3.00E-02 -5.70E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.68E-01 -1.60E-01 -3.95E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.99E-06 3.09E-01 2.41E+00
Influenza 1E30 Whole blood 1.85E-03 5.02E-01 4.75E+00
Interstitial cystitis GC00.3 Bladder tissue 7.22E-03 1.15E+00 2.56E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.37E-04 1.35E+00 1.50E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.15E-01 -1.87E-01 -5.52E-01
Ischemic stroke 8B11 Peripheral blood 3.48E-01 3.91E-03 1.06E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 4.81E-03 1.36E-01 3.67E-01
Lateral sclerosis 8B60.4 Skin 4.44E-01 3.20E-01 1.08E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 5.51E-01 -1.59E-01 -1.74E-01
Liver cancer 2C12.0 Liver tissue 2.48E-04 -2.20E-01 -6.72E-01
Liver failure DB99.7-DB99.8 Liver tissue 8.04E-05 1.10E+00 2.42E+00
Lung cancer 2C25 Lung tissue 1.07E-04 -5.66E-02 -1.98E-01
Lupus erythematosus 4A40 Whole blood 1.41E-10 5.83E-01 9.14E-01
Major depressive disorder 6A70-6A7Z Hippocampus 1.02E-01 -9.34E-02 -4.31E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.06E-01 7.96E-03 3.08E-02
Melanoma 2C30 Skin 5.52E-04 7.46E-01 9.84E-01
Multiple myeloma 2A83.1 Peripheral blood 3.91E-01 1.93E-01 2.67E-01
Multiple myeloma 2A83.1 Bone marrow 7.50E-01 3.07E-01 3.10E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.41E-02 3.48E-01 1.26E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.17E-03 2.98E-01 4.59E-01
Myelofibrosis 2A20.2 Whole blood 3.92E-01 3.57E-01 1.13E+00
Myocardial infarction BA41-BA50 Peripheral blood 2.15E-08 1.59E+00 1.43E+00
Myopathy 8C70.6 Muscle tissue 4.72E-05 1.56E+00 2.85E+00
Neonatal sepsis KA60 Whole blood 1.12E-25 7.93E-01 1.65E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.14E-01 -4.60E-02 -1.53E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 1.06E-02 6.57E-01 1.46E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.35E-01 -7.94E-02 -4.92E-01
Olive pollen allergy CA08.00 Peripheral blood 6.16E-01 -9.27E-02 -3.06E-01
Oral cancer 2B6E Oral tissue 7.96E-08 5.69E-01 1.24E+00
Osteoarthritis FA00-FA0Z Synovial tissue 4.04E-01 2.57E-01 2.31E-01
Osteoporosis FB83.1 Bone marrow 7.34E-01 1.69E-01 3.15E-01
Ovarian cancer 2C73 Ovarian tissue 9.57E-02 8.29E-01 8.62E-01
Pancreatic cancer 2C10 Pancreas 5.67E-03 6.85E-01 1.03E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 7.54E-01 2.23E-01 4.44E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 7.10E-05 6.06E-01 1.29E+00
Pituitary cancer 2D12 Pituitary tissue 1.52E-09 -1.93E+00 -3.85E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.29E-07 -1.87E+00 -3.33E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.83E-01 8.76E-02 2.95E-01
Polycythemia vera 2A20.4 Whole blood 4.66E-10 3.96E-01 1.29E+00
Pompe disease 5C51.3 Biceps muscle 1.75E-02 8.33E-01 1.46E+00
Preterm birth KA21.4Z Myometrium 8.75E-01 -7.58E-02 -1.49E-01
Prostate cancer 2C82 Prostate 4.74E-01 1.60E-01 4.49E-01
Psoriasis EA90 Skin 1.56E-03 2.16E-01 5.25E-01
Rectal cancer 2B92 Rectal colon tissue 1.02E-02 -2.08E-01 -1.46E+00
Renal cancer 2C90-2C91 Kidney 3.07E-01 6.02E-02 7.07E-02
Retinoblastoma 2D02.2 Uvea 1.38E-08 1.62E+00 4.13E+00
Rheumatoid arthritis FA20 Synovial tissue 4.89E-02 7.73E-01 8.53E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.41E-01 3.16E-02 2.66E-01
Schizophrenia 6A20 Prefrontal cortex 2.09E-02 1.93E-01 2.51E-01
Schizophrenia 6A20 Superior temporal cortex 2.48E-01 5.38E-02 1.47E-01
Scleroderma 4A42.Z Whole blood 2.72E-07 3.73E-01 3.17E+00
Seizure 8A60-8A6Z Whole blood 2.77E-01 4.70E-01 5.50E-01
Sensitive skin EK0Z Skin 2.83E-01 -1.95E-01 -5.19E-01
Sepsis with septic shock 1G41 Whole blood 3.07E-51 8.49E-01 1.82E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.21E-01 -3.72E-02 -1.01E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.55E-01 1.97E-01 9.58E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.11E-01 3.49E-02 5.59E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.88E-01 -7.95E-02 -3.40E-01
Skin cancer 2C30-2C3Z Skin 1.14E-31 7.00E-01 1.78E+00
Thrombocythemia 3B63 Whole blood 2.13E-02 3.80E-01 1.23E+00
Thrombocytopenia 3B64 Whole blood 6.98E-01 -7.33E-04 -1.99E-03
Thyroid cancer 2D10 Thyroid 5.02E-02 1.44E-01 5.82E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.14E-06 1.24E+00 2.00E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.83E-02 5.22E-01 2.79E+00
Type 2 diabetes 5A11 Liver tissue 5.02E-01 5.20E-02 3.71E-01
Ureter cancer 2C92 Urothelium 8.68E-01 1.94E+00 6.77E-01
Uterine cancer 2C78 Endometrium tissue 4.27E-01 6.44E-02 9.72E-02
Vitiligo ED63.0 Skin 4.93E-01 1.58E-01 5.33E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 The use of novel C-methylated spermidine derivatives to investigate the regulation of polyamine metabolism. J Med Chem. 2011 Jul 14;54(13):4611-8.
2 Mechanistic and structural analysis of human spermidine/spermine N1-acetyltransferase. Biochemistry. 2007 Jun 19;46(24):7187-95.