Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEN0GVQ)

DME Name Beta-HSD adrenal and gonadal type (HSD3B2)
Synonyms
Progesterone reductase; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II; 3-beta-HSD II; 3-beta-HSD adrenal and gonadal type; 3-beta-hydroxy-5-ene steroid dehydrogenase; 3-beta-hydroxy-Delta(5)-steroid dehydrogenase; HSD3B2; HSDB3B
Gene Name HSD3B2
UniProt ID
3BHS2_HUMAN
INTEDE ID
DME0222
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
3284
EC Number EC: 1.1.1.145
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.145
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEG
DILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFI
YTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLY
TCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALR
DPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLPLTLMYWIGFLLEVV
SFLLSPIYSYQPPFNRHTVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLV
DRHKETLKSKTQ
Function This enzyme catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids.
KEGG Pathway
Aldosterone synthesis and secretion (hsa04925 )
Cortisol synthesis and secretion (hsa04927 )
Cushing syndrome (hsa04934 )
Metabolic pathways (hsa01100 )
Ovarian steroidogenesis (hsa04913 )
Steroid hormone biosynthesis (hsa00140 )
Reactome Pathway
Glucocorticoid biosynthesis (R-HSA-194002 )
Mineralocorticoid biosynthesis (R-HSA-193993 )
Androgen biosynthesis (R-HSA-193048 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
4 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Norethindrone acetate DMDGCQP N. A. N. A. Approved [1]
Prasterone DM67VKL Chronic obstructive pulmonary disease CA22 Approved [2]
Tibolone DM78XFG Anabolic metabolism 5C50-5C8Z Approved [3]
Pregnenolone DM6VFO1 Schizophrenia 6A20 Phase 4 [4]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
17alpha-hydroxypregnenolone DMT2EPG Discovery agent N.A. Investigative [4]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
17alpha-hydroxypregnenolone Discovery agent [N.A.] Investigative Km = 0.0035 microM [4]
Pregnenolone Schizophrenia [6A20] Phase 4 Km = 0.0028 microM [4]
Prasterone Chronic obstructive pulmonary disease [CA22] Approved Km = 0.00164 microM [5]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 9.22E-01 -2.29E-02 -1.63E-01
Alopecia ED70 Skin from scalp 2.05E-06 1.60E-01 6.06E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.24E-02 -4.03E-02 -2.84E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.70E-01 -1.72E-02 -3.21E-01
Aortic stenosis BB70 Calcified aortic valve 9.47E-01 -3.71E-02 -7.65E-02
Apnea 7A40 Hyperplastic tonsil 2.68E-01 -1.08E-01 -4.73E-01
Arthropathy FA00-FA5Z Peripheral blood 7.93E-01 6.17E-04 3.53E-03
Asthma CA23 Nasal and bronchial airway 9.58E-01 2.40E-02 1.07E-01
Atopic dermatitis EA80 Skin 9.58E-01 8.25E-02 3.71E-01
Autism 6A02 Whole blood 2.78E-01 -1.16E-02 -6.01E-02
Autoimmune uveitis 9A96 Peripheral monocyte 5.20E-01 -1.37E-01 -6.54E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.04E-01 -2.14E-02 -1.28E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.61E-03 9.03E-02 4.35E-01
Batten disease 5C56.1 Whole blood 8.66E-01 1.44E-02 1.26E-01
Behcet's disease 4A62 Peripheral blood 7.93E-01 2.88E-02 1.58E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.62E-01 2.53E-02 1.71E-01
Bladder cancer 2C94 Bladder tissue 1.21E-03 9.38E-01 1.94E+00
Breast cancer 2C60-2C6Z Breast tissue 3.09E-22 -2.02E-01 -6.92E-01
Cardioembolic stroke 8B11.20 Whole blood 1.55E-03 1.42E-01 9.25E-01
Cervical cancer 2C77 Cervical tissue 9.40E-01 -2.09E-02 -5.02E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.84E-01 4.21E-02 2.43E-01
Chronic hepatitis C 1E51.1 Whole blood 1.13E-01 3.40E-02 3.05E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.87E-01 6.39E-02 3.88E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.04E-01 5.56E-02 3.35E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.45E-01 -7.19E-03 -7.61E-02
Colon cancer 2B90 Colon tissue 2.27E-24 -1.38E+00 -8.21E-01
Coronary artery disease BA80-BA8Z Peripheral blood 2.09E-01 -1.21E-01 -8.81E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.35E-01 -5.43E-02 -2.33E-01
Endometriosis GA10 Endometrium tissue 1.18E-01 1.38E-01 4.91E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.90E-01 -2.49E-02 -2.51E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.05E-01 -1.68E-01 -8.71E-01
Gastric cancer 2B72 Gastric tissue 4.26E-01 -3.77E-01 -1.19E+00
Glioblastopma 2A00.00 Nervous tissue 8.73E-04 -8.94E-02 -3.66E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.28E-01 1.65E-02 2.14E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 7.12E-03 -1.58E-01 -7.73E-01
Head and neck cancer 2D42 Head and neck tissue 1.36E-01 -4.32E-02 -6.59E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.36E-02 -6.46E-02 -2.30E-01
Huntington's disease 8A01.10 Whole blood 4.59E-01 -3.09E-03 -9.54E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.78E-01 -1.28E-02 -1.01E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.08E-01 3.13E-04 2.49E-03
Influenza 1E30 Whole blood 1.51E-01 1.94E-01 1.09E+00
Interstitial cystitis GC00.3 Bladder tissue 3.87E-02 2.27E-01 1.57E+00
Intracranial aneurysm 8B01.0 Intracranial artery 9.17E-01 -6.58E-02 -3.81E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 7.96E-01 2.62E-02 3.21E-02
Ischemic stroke 8B11 Peripheral blood 3.83E-01 4.94E-03 2.83E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 2.16E-02 9.26E-02 4.40E-01
Lateral sclerosis 8B60.4 Skin 5.59E-01 5.55E-02 4.74E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 2.64E-01 -1.35E-01 -7.99E-01
Liver cancer 2C12.0 Liver tissue 1.16E-08 -2.42E-01 -1.28E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.47E-06 -4.97E-01 -4.25E+00
Lung cancer 2C25 Lung tissue 2.95E-01 2.66E-02 1.05E-01
Lupus erythematosus 4A40 Whole blood 8.99E-01 2.23E-02 8.17E-02
Major depressive disorder 6A70-6A7Z Hippocampus 5.86E-01 2.59E-02 1.63E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.68E-01 5.84E-03 2.57E-02
Melanoma 2C30 Skin 8.94E-04 -4.34E-01 -7.80E-01
Multiple myeloma 2A83.1 Peripheral blood 3.50E-02 1.57E-01 1.08E+00
Multiple myeloma 2A83.1 Bone marrow 2.59E-04 -7.99E-01 -2.24E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.40E-01 4.40E-03 1.75E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.17E-03 -1.36E-01 -7.58E-01
Myelofibrosis 2A20.2 Whole blood 4.92E-06 1.54E-01 9.12E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.85E-02 5.58E-02 2.77E-01
Myopathy 8C70.6 Muscle tissue 1.27E-01 -1.72E-01 -6.23E-01
Neonatal sepsis KA60 Whole blood 1.12E-01 6.83E-02 3.91E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.81E-03 -5.03E-01 -1.46E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 9.36E-01 -1.37E-02 -8.32E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.17E-01 7.37E-02 7.80E-01
Olive pollen allergy CA08.00 Peripheral blood 8.43E-01 -1.92E-02 -1.28E-01
Oral cancer 2B6E Oral tissue 3.58E-04 -3.36E-01 -1.47E+00
Osteoarthritis FA00-FA0Z Synovial tissue 1.08E-01 -1.27E-01 -5.02E-01
Osteoporosis FB83.1 Bone marrow 2.62E-01 2.60E-02 1.82E-01
Ovarian cancer 2C73 Ovarian tissue 1.08E-01 -1.78E-01 -6.52E-02
Pancreatic cancer 2C10 Pancreas 5.50E-02 -2.51E-01 -6.18E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.17E-01 2.00E-02 1.23E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.65E-01 9.02E-03 9.23E-02
Pituitary cancer 2D12 Pituitary tissue 4.53E-01 1.04E-01 1.16E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.85E-01 4.70E-02 2.56E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.38E-02 -7.73E-02 -6.31E-01
Polycythemia vera 2A20.4 Whole blood 3.89E-09 2.00E-01 1.30E+00
Pompe disease 5C51.3 Biceps muscle 6.54E-01 8.86E-03 4.78E-02
Preterm birth KA21.4Z Myometrium 1.28E-01 -2.08E-01 -1.85E+00
Prostate cancer 2C82 Prostate 9.70E-02 -1.70E-01 -7.62E-01
Psoriasis EA90 Skin 8.88E-02 -5.38E-02 -3.16E-01
Rectal cancer 2B92 Rectal colon tissue 1.37E-01 -6.92E-01 -5.65E-01
Renal cancer 2C90-2C91 Kidney 3.63E-03 -3.38E-01 -1.33E+00
Retinoblastoma 2D02.2 Uvea 4.81E-01 -1.56E-01 -1.10E+00
Rheumatoid arthritis FA20 Synovial tissue 1.30E-02 -4.77E-01 -1.39E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.24E-01 -1.16E-02 -7.47E-02
Schizophrenia 6A20 Prefrontal cortex 2.39E-01 5.15E-02 2.14E-01
Schizophrenia 6A20 Superior temporal cortex 8.14E-01 -2.28E-02 -1.48E-01
Scleroderma 4A42.Z Whole blood 1.75E-01 -1.60E-01 -9.59E-01
Seizure 8A60-8A6Z Whole blood 6.17E-02 -7.94E-02 -3.90E-01
Sensitive skin EK0Z Skin 9.46E-01 5.27E-02 1.86E-01
Sepsis with septic shock 1G41 Whole blood 2.42E-01 2.13E-02 1.13E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.90E-01 2.63E-01 7.85E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.14E-01 9.87E-02 4.58E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.65E-01 -1.52E-02 -1.53E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.51E-01 -3.21E-02 -2.32E-01
Skin cancer 2C30-2C3Z Skin 3.63E-05 1.15E-01 3.63E-01
Thrombocythemia 3B63 Whole blood 5.07E-04 1.82E-01 1.19E+00
Thrombocytopenia 3B64 Whole blood 4.19E-01 -1.09E-01 -5.65E-01
Thyroid cancer 2D10 Thyroid 4.82E-03 -7.82E-02 -4.39E-01
Tibial muscular dystrophy 8C75 Muscle tissue 5.77E-03 -2.35E-01 -1.08E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 6.37E-01 5.80E-02 6.07E+00
Type 2 diabetes 5A11 Liver tissue 1.43E-01 -6.28E-02 -3.40E-01
Ureter cancer 2C92 Urothelium 1.02E-01 9.90E-02 6.65E-01
Uterine cancer 2C78 Endometrium tissue 5.02E-03 1.49E-01 4.54E-01
Vitiligo ED63.0 Skin 6.54E-01 -1.79E-02 -5.91E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Hormonal properties of norethisterone, 7alpha-methyl-norethisterone and their derivatives. J Steroid Biochem Mol Biol. 2000 Nov 15;74(4):213-22.
2 Selective inhibition of human 3beta-hydroxysteroid dehydrogenase type 1 as a potential treatment for breast cancer. J Steroid Biochem Mol Biol. 2011 May;125(1-2):57-65.
3 Tibolone: a unique version of hormone replacement therapy. Ann Pharmacother. 2004 May;38(5):874-81.
4 Structure/function relationships responsible for the kinetic differences between human type 1 and type 2 3beta-hydroxysteroid dehydrogenase and for the catalysis of the type 1 activity. J Biol Chem. 2002 Nov 8;277(45):42795-801.
5 Identification of key amino acids responsible for the substantially higher affinities of human type 1 3beta-hydroxysteroid dehydrogenase/isomerase (3beta-HSD1) for substrates, coenzymes, and inhibitors relative to human 3beta-HSD2. J Biol Chem. 2005 Jun 3;280(22):21321-8.