Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEOY5ZM)

DME Name Aldo-keto reductase 1C2 (AKR1C2)
Synonyms
Aldo-keto reductase family 1 member C2; Chlordecone reductase homolog HAKRD; DD-2; DD/BABP; DD2; DDH2; Dihydrodiol dehydrogenase 2; Dihydrodiol dehydrogenase/bile acid-binding protein; Type III 3-alpha-hydroxysteroid dehydrogenase; 3-alpha-HSD3; AKR1C2
Gene Name AKR1C2
UniProt ID
AK1C2_HUMAN
INTEDE ID
DME0233
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1646
EC Number EC: 1.1.1.357
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.357
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV
SVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKP
GLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN
RNVRYLTLDIFAGPPNYPFSDEY
Function
This enzyme works in concert with the 5-alpha/5-beta-steroid reductases to convert steroid hormones into the 3-alpha/5-alpha and 3-alpha/5-beta-tetrahydrosteroids, and it catalyzes the inactivation of the most potent androgen 5-alpha-dihydrotestosterone (5-alpha-DHT) to 5-alpha- androstane-3-alpha,17-beta-diol (3-alpha-diol).
KEGG Pathway
Chemical carcinogenesis (hsa05204 )
Steroid hormone biosynthesis (hsa00140 )
Reactome Pathway
Synthesis of bile acids and bile salts via 27-hydroxycholesterol (R-HSA-193807 )
Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol (R-HSA-193368 )
Synthesis of bile acids and bile salts via 24-hydroxycholesterol (R-HSA-193775 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
FENOFIBRIC ACID DMGO2MC Cardiovascular disease BA00-BE2Z Approved [1]
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Trastuzumab emtansine DMU1LXS HER2-positive breast cancer 2C60-2C65 Phase 2 [2]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
BRN-3548355 DM4KXT0 N. A. N. A. Investigative [3]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.05E-07 -3.79E-01 -7.08E-01
Alopecia ED70 Skin from scalp 3.56E-02 2.58E-01 5.24E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.11E-02 1.03E-01 2.34E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 9.96E-01 5.42E-02 8.53E-02
Aortic stenosis BB70 Calcified aortic valve 2.78E-01 -3.90E-01 -2.15E-01
Apnea 7A40 Hyperplastic tonsil 4.48E-02 -2.64E+00 -1.82E+00
Arthropathy FA00-FA5Z Peripheral blood 4.35E-01 -2.15E-03 -7.34E-03
Asthma CA23 Nasal and bronchial airway 1.57E-02 4.27E-01 5.77E-01
Atopic dermatitis EA80 Skin 5.52E-02 -1.84E-01 -3.35E-01
Autism 6A02 Whole blood 9.18E-01 -6.64E-02 -1.85E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.97E-01 -1.15E-01 -4.17E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.13E-01 4.21E-01 1.20E+00
Bacterial infection of gingival 1C1H Gingival tissue 4.81E-06 -4.04E-01 -6.98E-01
Batten disease 5C56.1 Whole blood 6.60E-01 8.08E-03 2.23E-02
Behcet's disease 4A62 Peripheral blood 5.04E-01 1.25E-01 4.26E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.69E-01 1.03E-01 2.80E-01
Bladder cancer 2C94 Bladder tissue 7.35E-10 -1.61E+00 -4.29E+00
Breast cancer 2C60-2C6Z Breast tissue 3.05E-99 -3.98E+00 -2.37E+00
Cardioembolic stroke 8B11.20 Whole blood 9.54E-02 9.05E-03 2.40E-02
Cervical cancer 2C77 Cervical tissue 7.06E-01 1.19E-02 1.35E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.92E-01 8.99E-02 3.98E-01
Chronic hepatitis C 1E51.1 Whole blood 8.24E-01 1.99E-02 8.52E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 4.65E-01 -1.69E-01 -3.89E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.63E-06 8.01E-01 8.40E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 4.08E-01 -5.41E-01 -8.26E-01
Colon cancer 2B90 Colon tissue 1.01E-81 -1.33E+00 -2.67E+00
Coronary artery disease BA80-BA8Z Peripheral blood 1.50E-01 1.89E-01 8.79E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.23E-01 -7.93E-03 -3.09E-02
Endometriosis GA10 Endometrium tissue 7.36E-01 2.17E-01 1.82E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.70E-01 -6.10E-02 -3.86E-01
Familial hypercholesterolemia 5C80.00 Whole blood 6.81E-02 -9.77E-02 -3.34E-01
Gastric cancer 2B72 Gastric tissue 1.77E-01 -2.38E+00 -1.64E+00
Glioblastopma 2A00.00 Nervous tissue 1.40E-29 -5.50E-01 -8.59E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 4.05E-02 -6.32E-01 -2.06E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.81E-03 1.58E+00 1.38E+00
Head and neck cancer 2D42 Head and neck tissue 5.26E-02 -3.29E-01 -2.67E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.12E-02 -2.54E-01 -7.80E-01
Huntington's disease 8A01.10 Whole blood 9.44E-02 1.58E-01 8.39E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.53E-01 -8.30E-01 -1.18E+00
Immunodeficiency 4A00-4A20 Peripheral blood 8.53E-01 -1.53E-01 -6.35E-01
Influenza 1E30 Whole blood 4.38E-01 -2.25E-01 -2.75E-01
Interstitial cystitis GC00.3 Bladder tissue 5.98E-06 -1.96E+00 -4.84E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.30E-01 -1.61E-01 -3.11E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.86E-04 -2.52E-01 -6.23E-01
Ischemic stroke 8B11 Peripheral blood 9.62E-01 1.91E-02 7.07E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 3.02E-03 -2.09E-01 -5.59E-01
Lateral sclerosis 8B60.4 Skin 1.61E-01 5.53E-01 7.58E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.12E-01 -2.65E-01 -3.05E-01
Liver cancer 2C12.0 Liver tissue 2.99E-01 2.35E-01 4.77E-01
Liver failure DB99.7-DB99.8 Liver tissue 3.09E-01 -8.37E-01 -1.68E+00
Lung cancer 2C25 Lung tissue 7.85E-05 -4.33E-02 -8.66E-02
Lupus erythematosus 4A40 Whole blood 5.62E-01 -4.04E-02 -7.34E-02
Major depressive disorder 6A70-6A7Z Hippocampus 6.23E-01 1.97E-01 5.37E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.94E-01 -1.74E-02 -4.24E-02
Melanoma 2C30 Skin 2.05E-05 -1.44E+00 -1.11E+00
Multiple myeloma 2A83.1 Peripheral blood 9.41E-01 2.58E-01 3.58E-01
Multiple myeloma 2A83.1 Bone marrow 3.48E-01 -1.66E-01 -7.59E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.28E-01 -8.70E-02 -1.85E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.64E-01 1.76E-01 4.76E-01
Myelofibrosis 2A20.2 Whole blood 5.88E-03 3.04E-01 1.49E+00
Myocardial infarction BA41-BA50 Peripheral blood 8.87E-03 1.65E-01 3.16E-01
Myopathy 8C70.6 Muscle tissue 2.38E-02 7.17E-01 9.54E-01
Neonatal sepsis KA60 Whole blood 5.85E-01 -5.78E-02 -1.60E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.93E-13 -2.40E+00 -6.09E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.16E-01 3.74E-01 1.06E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.01E-01 2.77E-01 6.16E-01
Olive pollen allergy CA08.00 Peripheral blood 2.37E-01 -5.36E-01 -1.48E+00
Oral cancer 2B6E Oral tissue 6.56E-01 9.84E-02 6.53E-02
Osteoarthritis FA00-FA0Z Synovial tissue 8.69E-01 -4.05E-02 -6.91E-02
Osteoporosis FB83.1 Bone marrow 3.28E-02 -1.23E+00 -2.37E+00
Ovarian cancer 2C73 Ovarian tissue 7.42E-03 -9.01E-01 -1.48E+00
Pancreatic cancer 2C10 Pancreas 1.56E-01 2.05E-01 2.16E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 3.46E-03 6.99E-01 1.74E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.25E-01 1.60E-02 6.30E-02
Pituitary cancer 2D12 Pituitary tissue 3.45E-03 -1.00E+00 -1.09E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.92E-04 -1.37E+00 -1.69E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.49E-01 -4.38E-01 -6.81E-01
Polycythemia vera 2A20.4 Whole blood 5.63E-05 1.74E-01 7.79E-01
Pompe disease 5C51.3 Biceps muscle 8.53E-08 1.85E+00 4.05E+00
Preterm birth KA21.4Z Myometrium 3.07E-01 1.33E-01 3.61E-01
Prostate cancer 2C82 Prostate 2.93E-02 -1.86E-01 -1.47E-01
Psoriasis EA90 Skin 8.56E-07 -3.34E-01 -6.58E-01
Rectal cancer 2B92 Rectal colon tissue 3.26E-06 -1.21E+00 -4.54E+00
Renal cancer 2C90-2C91 Kidney 4.71E-01 -9.49E-04 -1.00E-03
Retinoblastoma 2D02.2 Uvea 8.86E-10 -3.82E+00 -1.08E+01
Rheumatoid arthritis FA20 Synovial tissue 1.47E-03 6.63E-01 1.13E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.42E-01 -1.25E-01 -3.28E-01
Schizophrenia 6A20 Prefrontal cortex 2.15E-02 -2.54E-01 -3.23E-01
Schizophrenia 6A20 Superior temporal cortex 8.19E-02 -1.74E-01 -7.88E-01
Scleroderma 4A42.Z Whole blood 8.35E-01 -4.43E-02 -1.17E-01
Seizure 8A60-8A6Z Whole blood 5.37E-01 4.47E-02 1.65E-01
Sensitive skin EK0Z Skin 8.09E-01 -3.17E-02 -1.11E-01
Sepsis with septic shock 1G41 Whole blood 6.66E-01 -6.87E-02 -2.12E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.24E-01 2.16E-01 5.69E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.15E-01 1.71E-02 1.23E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.39E-01 -7.91E-02 -3.90E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.64E-01 -3.80E-02 -6.03E-01
Skin cancer 2C30-2C3Z Skin 1.13E-116 -2.81E+00 -4.77E+00
Thrombocythemia 3B63 Whole blood 1.32E-02 1.41E-01 6.78E-01
Thrombocytopenia 3B64 Whole blood 5.08E-01 2.31E+00 1.13E+00
Thyroid cancer 2D10 Thyroid 5.94E-43 -1.67E+00 -3.06E+00
Tibial muscular dystrophy 8C75 Muscle tissue 2.60E-01 -1.58E-01 -1.81E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.04E-01 2.02E-01 9.86E-01
Type 2 diabetes 5A11 Liver tissue 1.85E-01 -7.62E-02 -5.46E-01
Ureter cancer 2C92 Urothelium 1.13E-01 1.06E-01 2.73E-01
Uterine cancer 2C78 Endometrium tissue 3.52E-08 7.21E-01 5.91E-01
Vitiligo ED63.0 Skin 4.16E-01 -4.66E-02 -1.45E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 In vitro metabolism of fenofibric acid by carbonyl reducing enzymes. Chem Biol Interact. 2016 Oct 25;258:153-8.
2 The role of carbonyl reducing enzymes in oxcarbazepine in vitro metabolism in man. Chem Biol Interact. 2014 Sep 5;220:241-7.
3 Characterization of enzymes participating in carbonyl reduction of 4-methylnitrosamino-1-(3-pyridyl)-1-butanone (NNK) in human placenta. Chem Biol Interact. 2001 Jan 30;130-132(1-3):737-48.