Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEP76YL)

DME Name Dimethylaniline oxidase 3 (FMO3)
Synonyms Dimethylaniline monooxygenase [N-oxide-forming] 3; FMO 3; FMO II; FMO form 2; FMO3; Hepatic flavin-containing monooxygenase 3; Trimethylamine monooxygenase
Gene Name FMO3
UniProt ID
FMO3_HUMAN
INTEDE ID
DME0039
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
2328
EC Number EC: 1.14.13.8
Oxidoreductase
Oxygen paired donor oxidoreductase
NADH/NADPH donor oxidoreductase
EC: 1.14.13.8
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEGRASIYKSVFS
NSSKEMMCFPDFPFPDDFPNFMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFA
TTGQWDVTTERDGKKESAVFDAVMVCSGHHVYPNLPKESFPGLNHFKGKCFHSRDYKEPG
VFNGKRVLVVGLGNSGCDIATELSRTAEQVMISSRSGSWVMSRVWDNGYPWDMLLVTRFG
TFLKNNLPTAISDWLYVKQMNARFKHENYGLMPLNGVLRKEPVFNDELPASILCGIVSVK
PNVKEFTETSAIFEDGTIFEGIDCVIFATGYSFAYPFLDESIIKSRNNEIILFKGVFPPL
LEKSTIAVIGFVQSLGAAIPTVDLQSRWAAQVIKGTCTLPSMEDMMNDINEKMEKKRKWF
GKSETIQTDYIVYMDELSSFIGAKPNIPWLFLTDPKLAMEVYFGPCSPYQFRLVGPGQWP
GARNAILTQWDRSLKPMQTRVVGRLQKPCFFFHWLKLFAIPILLIAVFLVLT
Function
This enzyme catalyzes the oxygenation of a wide variety of nitrogen- and sulfur-containing compounds including drugs as well as dietary compounds. It plays an important role in the metabolism of trimethylamine (TMA), via the production of trimethylamine N-oxide (TMAO) metabolite.
KEGG Pathway
Drug metabolism - cytochrome P450 (hsa00982 )
Reactome Pathway
FMO oxidises nucleophiles (R-HSA-217271 )
Defective FMO3 causes Trimethylaminuria (TMAU) (R-HSA-5579019 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
5 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Almotriptan malate DMFG5ST N. A. N. A. Approved [1]
Dasatinib DMJV2EK Blast phase chronic myelogenous leukemia, BCR-ABL1 positive Approved [2]
Ethionamide DM8K3EI Pulmonary tuberculosis 1B10.Z Approved [3]
Fedratinib hydrochloride DML2DCR N. A. N. A. Approved [4]
Olopatadine DMKMWQG Allergic conjunctivitis 9A60.02 Approved []
2 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
HSR-803 DMAVIPZ N. A. N. A. Phase 3 [5]
Itopride DM7MLTR N. A. N. A. Phase 3 [5]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 9.01E-01 -1.65E-02 -3.30E-02
Alopecia ED70 Skin from scalp 5.51E-02 1.09E-01 3.58E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.12E-05 1.49E-01 6.95E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 9.22E-01 -3.34E-02 -2.45E-01
Aortic stenosis BB70 Calcified aortic valve 1.53E-01 1.22E+00 9.68E-01
Apnea 7A40 Hyperplastic tonsil 3.95E-01 8.84E-02 8.13E-01
Arthropathy FA00-FA5Z Peripheral blood 3.35E-01 1.50E-02 1.51E-01
Asthma CA23 Nasal and bronchial airway 2.57E-04 8.14E-01 4.57E-01
Atopic dermatitis EA80 Skin 3.55E-01 -4.13E-01 -5.25E-01
Autism 6A02 Whole blood 8.04E-01 9.64E-03 8.47E-02
Autoimmune uveitis 9A96 Peripheral monocyte 1.81E-01 -1.01E-01 -1.36E+00
Autosomal dominant monocytopenia 4B04 Whole blood 4.38E-01 -7.11E-03 -7.55E-02
Bacterial infection of gingival 1C1H Gingival tissue 6.48E-04 3.75E-01 5.94E-01
Batten disease 5C56.1 Whole blood 1.91E-01 3.32E-02 9.20E-01
Behcet's disease 4A62 Peripheral blood 7.54E-01 -4.43E-02 -2.40E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.31E-01 8.77E-03 4.57E-02
Bladder cancer 2C94 Bladder tissue 8.38E-03 3.34E-01 9.27E-01
Breast cancer 2C60-2C6Z Breast tissue 1.17E-16 -1.09E+00 -8.71E-01
Cardioembolic stroke 8B11.20 Whole blood 1.27E-06 1.47E-01 1.52E+00
Cervical cancer 2C77 Cervical tissue 1.77E-03 5.83E-02 1.68E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.05E-01 4.66E-02 4.19E-01
Chronic hepatitis C 1E51.1 Whole blood 6.98E-01 4.36E-02 3.36E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.69E-01 2.85E-02 5.33E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.72E-06 -7.16E-01 -9.20E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 4.61E-01 -6.65E-03 -5.28E-03
Colon cancer 2B90 Colon tissue 1.27E-53 2.84E-01 1.46E+00
Coronary artery disease BA80-BA8Z Peripheral blood 2.90E-01 -9.62E-02 -4.23E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.94E-01 8.07E-02 3.55E-01
Endometriosis GA10 Endometrium tissue 6.29E-01 -1.27E-02 -6.79E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.78E-01 -2.32E-02 -2.72E-01
Familial hypercholesterolemia 5C80.00 Whole blood 5.42E-07 -1.66E-01 -1.36E+00
Gastric cancer 2B72 Gastric tissue 2.54E-01 3.59E-01 3.90E-01
Glioblastopma 2A00.00 Nervous tissue 2.53E-32 1.04E-01 4.12E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 9.09E-01 -1.88E-01 -6.02E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 7.88E-01 -6.25E-03 -7.78E-02
Head and neck cancer 2D42 Head and neck tissue 2.10E-08 -1.80E+00 -9.41E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.47E-01 -6.46E-02 -2.97E-01
Huntington's disease 8A01.10 Whole blood 4.71E-01 -3.46E-02 -2.15E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.40E-03 9.08E-01 1.54E+00
Immunodeficiency 4A00-4A20 Peripheral blood 8.85E-01 1.93E-02 2.89E-01
Influenza 1E30 Whole blood 6.08E-02 8.31E-02 1.46E+00
Interstitial cystitis GC00.3 Bladder tissue 7.77E-04 1.01E+00 4.09E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.28E-02 1.28E+00 1.50E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.70E-02 4.73E-02 2.64E-01
Ischemic stroke 8B11 Peripheral blood 7.32E-01 -3.25E-02 -4.27E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 8.87E-02 7.01E-02 3.21E-01
Lateral sclerosis 8B60.4 Skin 9.51E-01 7.48E-03 7.59E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 1.95E-01 -2.39E-01 -1.95E-01
Liver cancer 2C12.0 Liver tissue 8.92E-20 -6.84E-01 -1.03E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.30E-03 -2.37E+00 -5.19E+00
Lung cancer 2C25 Lung tissue 4.37E-47 -1.47E+00 -1.75E+00
Lupus erythematosus 4A40 Whole blood 1.80E-01 -7.06E-02 -2.84E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.08E-01 -1.13E-02 -6.65E-02
Major depressive disorder 6A70-6A7Z Whole blood 3.61E-01 2.90E-02 1.55E-01
Melanoma 2C30 Skin 7.30E-01 -4.59E-01 -3.63E-01
Multiple myeloma 2A83.1 Peripheral blood 9.88E-01 5.88E-02 6.73E-01
Multiple myeloma 2A83.1 Bone marrow 1.19E-07 1.93E-01 1.92E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.94E-01 -4.36E-01 -5.88E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.74E-01 -2.46E-03 -6.75E-03
Myelofibrosis 2A20.2 Whole blood 9.61E-03 1.09E-01 1.17E+00
Myocardial infarction BA41-BA50 Peripheral blood 5.41E-02 2.17E-01 6.98E-01
Myopathy 8C70.6 Muscle tissue 1.33E-01 2.75E-01 3.64E-01
Neonatal sepsis KA60 Whole blood 6.33E-01 -1.68E-02 -1.42E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.95E-01 -2.39E-01 -6.80E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 4.06E-02 4.30E-01 8.44E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.47E-01 -4.50E-01 -6.93E-01
Olive pollen allergy CA08.00 Peripheral blood 8.84E-01 2.68E-02 2.17E-01
Oral cancer 2B6E Oral tissue 7.43E-04 4.85E-01 7.32E-01
Osteoarthritis FA00-FA0Z Synovial tissue 9.10E-01 -3.77E-01 -4.00E-01
Osteoporosis FB83.1 Bone marrow 4.16E-01 7.65E-01 4.04E-01
Ovarian cancer 2C73 Ovarian tissue 6.12E-01 7.94E-02 9.17E-02
Pancreatic cancer 2C10 Pancreas 8.35E-02 4.38E-01 4.56E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 6.50E-01 -8.95E-02 -6.55E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.40E-02 -8.06E-02 -9.51E-01
Pituitary cancer 2D12 Pituitary tissue 2.96E-02 -6.64E-01 -9.01E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.18E-03 -6.31E-01 -1.05E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.52E-01 -1.96E-02 -9.59E-02
Polycythemia vera 2A20.4 Whole blood 8.34E-03 8.68E-02 7.26E-01
Pompe disease 5C51.3 Biceps muscle 2.52E-01 -1.01E-01 -1.36E-01
Preterm birth KA21.4Z Myometrium 2.44E-01 -6.77E-02 -7.35E-01
Prostate cancer 2C82 Prostate 4.07E-01 7.23E-02 6.45E-02
Psoriasis EA90 Skin 2.13E-08 3.84E-01 5.83E-01
Rectal cancer 2B92 Rectal colon tissue 1.12E-01 3.59E-01 8.61E-01
Renal cancer 2C90-2C91 Kidney 2.61E-01 5.79E-01 4.26E-01
Retinoblastoma 2D02.2 Uvea 1.34E-03 6.63E-01 5.47E+00
Rheumatoid arthritis FA20 Synovial tissue 2.68E-01 4.58E-01 6.77E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.13E-01 1.12E-02 2.35E-02
Schizophrenia 6A20 Prefrontal cortex 9.30E-02 -5.07E-02 -2.23E-01
Schizophrenia 6A20 Superior temporal cortex 1.79E-01 6.08E-02 5.17E-01
Scleroderma 4A42.Z Whole blood 9.40E-03 1.13E-01 1.16E+00
Seizure 8A60-8A6Z Whole blood 5.78E-02 -1.17E-01 -1.06E+00
Sensitive skin EK0Z Skin 1.06E-01 3.34E-01 1.28E+00
Sepsis with septic shock 1G41 Whole blood 4.06E-01 4.10E-03 3.02E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.01E-01 -2.27E-02 -5.40E-02
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.11E-01 4.68E-02 3.84E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.94E-01 4.99E-02 6.23E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.82E-01 2.30E-01 6.31E-01
Skin cancer 2C30-2C3Z Skin 3.68E-02 -4.53E-01 -6.13E-01
Thrombocythemia 3B63 Whole blood 5.34E-02 1.12E-01 1.17E+00
Thrombocytopenia 3B64 Whole blood 5.62E-01 1.27E-02 5.44E-02
Thyroid cancer 2D10 Thyroid 8.65E-03 2.18E-01 3.56E-01
Tibial muscular dystrophy 8C75 Muscle tissue 6.59E-02 -8.68E-01 -1.66E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.26E-01 3.06E-02 2.77E-01
Type 2 diabetes 5A11 Liver tissue 1.00E+00 2.13E-02 6.48E-02
Ureter cancer 2C92 Urothelium 1.95E-01 -4.23E-02 -3.59E-01
Uterine cancer 2C78 Endometrium tissue 2.63E-10 1.41E-01 3.96E-01
Vitiligo ED63.0 Skin 2.89E-01 -3.27E-01 -6.03E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Identification of the human liver enzymes involved in the metabolism of the antimigraine agent almotriptan. Drug Metab Dispos. 2003 Apr;31(4):404-11.
2 Identification of the human enzymes involved in the oxidative metabolism of dasatinib: an effective approach for determining metabolite formation kinetics. Drug Metab Dispos. 2008 Sep;36(9):1828-39.
3 Physiologically based pharmacokinetic modeling approach to predict drug-drug interactions with ethionamide involving impact of genetic polymorphism on FMO3. J Clin Pharmacol. 2019 Jun;59(6):880-889.
4 FDA label of Fedratinib. The 2020 official website of the U.S. Food and Drug Administration.
5 Development of a physiologically based pharmacokinetic model to predict the effects of flavin-containing monooxygenase 3 (FMO3) polymorphisms on itopride exposure. Biopharm Drug Dispos. 2017 Sep;38(6):389-393.