General Information of Drug-Metabolizing Enzyme (DME) (ID: DEPVE0M)

DME Name Tryptophanyl-tRNA synthetase cytoplasmic (WARS1)
Synonyms Interferon-induced protein 53; Cytoplasmic tryptophan--tRNA ligase; Tryptophanyl-tRNA synthetase; T1-TrpRS; T2-TrpRS; TrpRS; IFI53; IFP53; WARS; WARS1; WRS; hWRS
Gene Name WARS1
UniProt ID
SYWC_HUMAN
INTEDE ID
DME0175
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
7453
EC Number EC: 6.1.1.2
Ligase
Carbon-oxygen ligase
Aminoacyl tRNA synthetase
EC: 6.1.1.2
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKA
DCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRI
ERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFT
KWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDY
MGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDR
TDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIF
LTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDY
TSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ
Function This enzyme has aminoacylation activity while T2-TrpRS lacks it.
KEGG Pathway
Aminoacyl-tRNA biosynthesis (hsa00970 )
Reactome Pathway
Cytosolic tRNA aminoacylation (R-HSA-379716 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-Tryptophan DMIBH7M Depression 6A70-6A7Z Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 7.96E-03 -2.01E-01 -4.50E-01
Alopecia ED70 Skin from scalp 9.78E-03 6.08E-02 2.50E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.98E-07 -3.42E-01 -7.39E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.42E-01 -1.17E-01 -3.01E-01
Aortic stenosis BB70 Calcified aortic valve 9.16E-01 -7.86E-02 -7.72E-02
Apnea 7A40 Hyperplastic tonsil 6.59E-03 4.80E-01 1.88E+00
Arthropathy FA00-FA5Z Peripheral blood 4.53E-01 1.31E-01 4.06E-01
Asthma CA23 Nasal and bronchial airway 7.47E-03 1.51E-01 1.75E-01
Atopic dermatitis EA80 Skin 2.23E-02 8.46E-02 5.43E-01
Autism 6A02 Whole blood 9.78E-01 8.01E-02 1.57E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.91E-01 1.34E-01 2.81E-01
Autosomal dominant monocytopenia 4B04 Whole blood 7.15E-02 7.34E-01 1.15E+00
Bacterial infection of gingival 1C1H Gingival tissue 1.06E-11 6.59E-01 1.27E+00
Batten disease 5C56.1 Whole blood 6.61E-01 1.37E-03 2.38E-03
Behcet's disease 4A62 Peripheral blood 1.74E-01 3.54E-01 9.64E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.07E-02 -8.31E-02 -3.27E-01
Bladder cancer 2C94 Bladder tissue 2.72E-01 -7.70E-02 -4.02E-01
Breast cancer 2C60-2C6Z Breast tissue 1.38E-22 2.70E-01 5.08E-01
Cardioembolic stroke 8B11.20 Whole blood 8.15E-02 1.66E-01 5.22E-01
Cervical cancer 2C77 Cervical tissue 2.61E-08 4.13E-01 1.24E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.78E-01 -2.11E-02 -4.19E-02
Chronic hepatitis C 1E51.1 Whole blood 6.43E-01 -2.53E-01 -2.37E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.57E-01 1.16E-01 2.71E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.77E-02 1.86E-01 3.36E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.89E-01 6.96E-02 2.33E-01
Colon cancer 2B90 Colon tissue 3.05E-27 5.33E-01 1.10E+00
Coronary artery disease BA80-BA8Z Peripheral blood 6.66E-01 -3.89E-01 -3.86E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.61E-01 -4.70E-01 -7.13E-01
Endometriosis GA10 Endometrium tissue 4.56E-03 -2.77E-01 -3.81E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.12E-02 -3.93E-01 -8.57E-01
Familial hypercholesterolemia 5C80.00 Whole blood 4.21E-07 1.17E+00 1.36E+00
Gastric cancer 2B72 Gastric tissue 5.06E-01 9.35E-01 7.09E-01
Glioblastopma 2A00.00 Nervous tissue 4.34E-01 -2.17E-01 -3.77E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.67E-01 -7.54E-01 -1.50E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.59E-03 1.42E+00 1.67E+00
Head and neck cancer 2D42 Head and neck tissue 8.24E-11 9.63E-01 8.89E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.59E-02 2.86E-01 5.86E-01
Huntington's disease 8A01.10 Whole blood 5.69E-01 -4.16E-02 -3.80E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.50E-01 1.37E-01 8.39E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.81E-04 5.31E-01 3.10E+00
Influenza 1E30 Whole blood 1.37E-01 1.52E+00 1.48E+00
Interstitial cystitis GC00.3 Bladder tissue 4.22E-05 1.73E+00 7.64E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.51E-02 4.88E-01 1.13E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 7.94E-01 -1.03E-01 -1.88E-01
Ischemic stroke 8B11 Peripheral blood 1.36E-01 -1.55E-01 -4.32E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 8.77E-05 -3.92E-01 -5.07E-01
Lateral sclerosis 8B60.4 Skin 9.77E-01 -9.31E-02 -2.38E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 8.30E-01 4.79E-01 6.05E-01
Liver cancer 2C12.0 Liver tissue 9.12E-02 9.66E-02 1.91E-01
Liver failure DB99.7-DB99.8 Liver tissue 8.25E-05 9.68E-01 3.18E+00
Lung cancer 2C25 Lung tissue 2.27E-52 -8.08E-01 -1.68E+00
Lupus erythematosus 4A40 Whole blood 6.78E-02 2.62E-01 3.07E-01
Major depressive disorder 6A70-6A7Z Hippocampus 3.18E-01 5.77E-02 2.97E-01
Major depressive disorder 6A70-6A7Z Whole blood 5.80E-01 9.90E-03 1.74E-02
Melanoma 2C30 Skin 7.45E-06 1.09E+00 1.30E+00
Multiple myeloma 2A83.1 Peripheral blood 4.76E-01 -1.00E+00 -1.03E+00
Multiple myeloma 2A83.1 Bone marrow 1.30E-05 8.98E-01 2.72E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.42E-01 1.64E-01 6.40E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.13E-01 9.81E-02 2.35E-01
Myelofibrosis 2A20.2 Whole blood 2.24E-01 -9.75E-02 -2.30E-01
Myocardial infarction BA41-BA50 Peripheral blood 2.36E-02 4.44E-01 4.90E-01
Myopathy 8C70.6 Muscle tissue 1.18E-04 8.85E-01 2.06E+00
Neonatal sepsis KA60 Whole blood 6.81E-03 2.13E-01 3.77E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.38E-01 8.56E-02 1.50E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 1.11E-01 2.51E-01 9.78E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.95E-01 -4.05E-02 -6.34E-02
Olive pollen allergy CA08.00 Peripheral blood 3.47E-01 -5.58E-01 -5.77E-01
Oral cancer 2B6E Oral tissue 8.38E-28 1.79E+00 4.05E+00
Osteoarthritis FA00-FA0Z Synovial tissue 4.85E-01 9.77E-02 8.53E-02
Osteoporosis FB83.1 Bone marrow 5.76E-01 -1.62E-01 -2.60E-01
Ovarian cancer 2C73 Ovarian tissue 1.65E-05 1.42E+00 3.11E+00
Pancreatic cancer 2C10 Pancreas 3.97E-02 3.51E-01 5.15E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.39E-01 -2.51E-01 -3.97E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.26E-02 8.48E-01 1.04E+00
Pituitary cancer 2D12 Pituitary tissue 5.30E-01 4.73E-02 5.42E-02
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.23E-01 -1.33E-01 -1.38E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.25E-01 3.80E-02 2.58E-01
Polycythemia vera 2A20.4 Whole blood 5.52E-01 1.47E-01 3.52E-01
Pompe disease 5C51.3 Biceps muscle 2.26E-01 2.87E-01 4.80E-01
Preterm birth KA21.4Z Myometrium 5.82E-02 -6.97E-01 -1.39E+00
Prostate cancer 2C82 Prostate 2.96E-01 -3.13E-01 -4.48E-01
Psoriasis EA90 Skin 2.63E-19 4.61E-01 1.45E+00
Rectal cancer 2B92 Rectal colon tissue 7.83E-03 6.00E-01 1.59E+00
Renal cancer 2C90-2C91 Kidney 1.02E-01 4.70E-01 6.53E-01
Retinoblastoma 2D02.2 Uvea 5.41E-05 3.18E+00 1.14E+01
Rheumatoid arthritis FA20 Synovial tissue 8.36E-09 1.26E+00 5.20E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.50E-01 -7.69E-02 -1.07E-01
Schizophrenia 6A20 Prefrontal cortex 3.08E-01 4.58E-02 5.35E-02
Schizophrenia 6A20 Superior temporal cortex 1.83E-01 3.21E-02 1.05E-01
Scleroderma 4A42.Z Whole blood 8.54E-04 4.30E-01 1.53E+00
Seizure 8A60-8A6Z Whole blood 8.85E-01 7.99E-02 8.64E-02
Sensitive skin EK0Z Skin 4.19E-01 5.64E-03 4.74E-02
Sepsis with septic shock 1G41 Whole blood 2.44E-02 2.40E-03 3.69E-03
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.70E-01 -1.91E-01 -9.84E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.40E-03 -2.69E-01 -6.35E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.09E-01 8.32E-02 3.92E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.72E-01 4.59E-01 1.03E+00
Skin cancer 2C30-2C3Z Skin 1.66E-88 1.63E+00 4.23E+00
Thrombocythemia 3B63 Whole blood 3.04E-01 -1.26E-01 -2.97E-01
Thrombocytopenia 3B64 Whole blood 8.10E-01 1.48E-01 2.48E-01
Thyroid cancer 2D10 Thyroid 7.87E-07 7.00E-01 7.44E-01
Tibial muscular dystrophy 8C75 Muscle tissue 8.44E-01 -3.96E-02 -1.40E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.35E-02 -4.71E-01 -3.86E+00
Type 2 diabetes 5A11 Liver tissue 9.61E-02 2.55E-01 1.39E+00
Ureter cancer 2C92 Urothelium 4.21E-01 -7.31E-02 -9.23E-02
Uterine cancer 2C78 Endometrium tissue 4.01E-03 1.70E-01 2.59E-01
Vitiligo ED63.0 Skin 7.68E-01 4.59E-03 2.65E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 IFN-gamma-induced IDO and WRS expression in microglia is differentially regulated by IL-4. Glia. 2007 Oct;55(13):1385-96.