General Information of Drug-Metabolizing Enzyme (DME) (ID: DEQIZP2)

DME Name Chondroitin 6-sulfotransferase (CHST3)
Synonyms Carbohydrate sulfotransferase 3; Chondroitin 6-O-sulfotransferase 1; Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 0; C6ST-1; CHST3; GST-0
Gene Name CHST3
UniProt ID
CHST3_HUMAN
INTEDE ID
DME0632
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
9469
EC Number EC: 2.8.2.17
Transferase
Sulfotransferase
Sulfotransferase
EC: 2.8.2.17
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MEKGLTLPQDCRDFVHSLKMRSKYALFLVFVVIVFVFIEKENKIISRVSDKLKQIPQALA
DANSTDPALILAENASLLSLSELDSAFSQLQSRLRNLSLQLGVEPAMEAAGEEEEEQRKE
EEPPRPAVAGPRRHVLLMATTRTGSSFVGEFFNQQGNIFYLFEPLWHIERTVSFEPGGAN
AAGSALVYRDVLKQLFLCDLYVLEHFITPLPEDHLTQFMFRRGSSRSLCEDPVCTPFVKK
VFEKYHCKNRRCGPLNVTLAAEACRRKEHMALKAVRIRQLEFLQPLAEDPRLDLRVIQLV
RDPRAVLASRMVAFAGKYKTWKKWLDDEGQDGLREEEVQRLRGNCESIRLSAELGLRQPA
WLRGRYMLVRYEDVARGPLQKAREMYRFAGIPLTPQVEDWIQKNTQAAHDGSGIYSTQKN
SSEQFEKWRFSMPFKLAQVVQAACGPAMRLFGYKLARDAAALTNRSVSLLEERGTFWVT
Function This enzyme utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the transfer of sulfate to position 6 of the N-acetylgalactosamine (GalNAc) residue of chondroitin.
KEGG Pathway
Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate (hsa00532 )
Reactome Pathway
Defective CHST3 causes SEDCJD (R-HSA-3595172 )
Chondroitin sulfate biosynthesis (R-HSA-2022870 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Chondroitin sulfate DM0N19Y N. A. N. A. Phase 4 [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.06E-01 -8.38E-02 -4.21E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.75E-06 3.61E-01 5.90E-01
Asthma CA23 Nasal and bronchial airway 2.37E-02 1.10E-01 1.41E-01
Behcet's disease 4A62 Peripheral blood 6.03E-01 7.03E-02 3.14E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.34E-01 1.19E-02 3.58E-02
Bladder cancer 2C94 Bladder tissue 4.94E-01 -1.12E-01 -2.34E-01
Breast cancer 2C60-2C6Z Breast tissue 1.33E-153 -1.08E+00 -3.34E+00
Colon cancer 2B90 Colon tissue 1.38E-28 2.94E-01 1.09E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.11E-01 -4.30E-02 -2.76E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.87E-01 -7.34E-02 -3.42E-01
Gastric cancer 2B72 Gastric tissue 4.34E-02 -1.22E+00 -2.55E+00
Glioblastopma 2A00.00 Nervous tissue 7.55E-46 7.94E-01 1.04E+00
Head and neck cancer 2D42 Head and neck tissue 1.06E-35 7.87E-01 1.97E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.26E-01 3.83E-01 7.31E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.57E-02 4.42E-01 1.12E+00
Interstitial cystitis GC00.3 Bladder tissue 3.39E-01 9.59E-02 2.84E-01
Ischemic stroke 8B11 Peripheral blood 6.68E-03 7.15E-02 3.56E-01
Liver cancer 2C12.0 Liver tissue 3.31E-02 -1.44E-01 -7.55E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.39E-03 5.90E-01 2.18E+00
Lung cancer 2C25 Lung tissue 3.62E-01 -7.59E-02 -1.97E-01
Lupus erythematosus 4A40 Whole blood 1.02E-01 -1.75E-01 -3.07E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.12E-01 -1.97E-02 -6.87E-02
Multiple myeloma 2A83.1 Bone marrow 6.51E-04 -3.41E-01 -1.93E+00
Multiple myeloma 2A83.1 Peripheral blood 2.62E-02 2.25E-01 1.33E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.27E-01 -1.09E-01 -3.82E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.34E-01 1.57E-02 1.26E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.57E-02 3.42E-01 6.99E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.78E-07 -8.33E-01 -3.33E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 7.91E-01 -1.34E-02 -1.20E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.35E-01 2.36E-01 5.63E-01
Olive pollen allergy CA08.00 Peripheral blood 7.60E-01 3.55E-03 1.95E-02
Oral cancer 2B6E Oral tissue 6.66E-06 4.66E-01 1.14E+00
Ovarian cancer 2C73 Ovarian tissue 6.17E-04 -1.06E+00 -1.71E+00
Pancreatic cancer 2C10 Pancreas 1.47E-01 4.43E-03 6.72E-03
Parkinson's disease 8A00.0 Substantia nigra tissue 1.34E-01 6.30E-01 1.14E+00
Pituitary cancer 2D12 Pituitary tissue 6.84E-02 -4.58E-01 -1.47E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.68E-01 4.66E-02 3.87E-01
Pompe disease 5C51.3 Biceps muscle 3.49E-04 2.01E+00 4.72E+00
Prostate cancer 2C82 Prostate 1.15E-07 -9.49E-01 -1.45E+00
Psoriasis EA90 Skin 1.63E-05 -1.84E-01 -4.01E-01
Rectal cancer 2B92 Rectal colon tissue 1.31E-04 4.85E-01 2.83E+00
Renal cancer 2C90-2C91 Kidney 4.63E-04 -5.54E-01 -2.06E+00
Retinoblastoma 2D02.2 Uvea 4.67E-06 9.59E-01 4.42E+00
Schizophrenia 6A20 Prefrontal cortex 9.33E-02 9.44E-02 1.92E-01
Schizophrenia 6A20 Superior temporal cortex 9.04E-01 4.89E-02 1.51E-01
Scleroderma 4A42.Z Whole blood 8.08E-01 5.14E-02 2.51E-01
Seizure 8A60-8A6Z Whole blood 8.01E-01 -1.22E-01 -5.38E-01
Sepsis with septic shock 1G41 Whole blood 3.86E-01 3.76E-03 1.16E-02
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.74E-02 1.72E-01 9.89E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.23E-01 4.54E-02 1.61E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.12E-01 -1.29E-02 -1.91E-01
Skin cancer 2C30-2C3Z Skin 1.33E-01 1.58E-02 3.90E-02
Thrombocythemia 3B63 Whole blood 1.39E-03 1.40E-01 7.87E-01
Thrombocytopenia 3B64 Whole blood 5.11E-01 9.78E-03 6.86E-02
Thyroid cancer 2D10 Thyroid 7.03E-07 -3.32E-01 -7.94E-01
Tibial muscular dystrophy 8C75 Muscle tissue 8.03E-02 2.08E-01 3.54E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.25E-02 5.01E-01 1.20E+00
Type 2 diabetes 5A11 Liver tissue 5.37E-01 -2.03E-02 -1.30E-01
Ureter cancer 2C92 Urothelium 9.08E-01 -2.65E-02 -1.24E-01
Uterine cancer 2C78 Endometrium tissue 1.92E-31 -8.16E-01 -1.58E+00
Vitiligo ED63.0 Skin 1.17E-01 -1.16E-01 -6.19E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 61 Diseases

References

1 Variants in chondroitin sulfate metabolism genes in thrombotic storm. Thromb Res. 2018 Jan;161:43-51.