Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DER3H9C)

DME Name Lipocalin-type prostaglandin-D synthase (PTGDS)
Synonyms Glutathione-independent PGD synthase; Prostaglandin-D2 synthase; PGD2 synthase; Prostaglandin-H2 D-isomerase; Beta-trace protein; Cerebrin-28; PDS; PGDS; PGDS2; PTGDS
Gene Name PTGDS
UniProt ID
PTGDS_HUMAN
INTEDE ID
DME0572
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
5730
EC Number EC: 5.3.99.2
Isomerase
Intramolecular oxidoreductase
Intramolecular oxidoreductase
EC: 5.3.99.2
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLASNSSWLREKKA
ALSMCKSVVAPATDGGLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSV
VETDYDQYALLYSQGSKGPGEDFRMATLYSRTQTPRAELKEKFTAFCKAQGFTEDTIVFL
PQTDKCMTEQ
Function
This enzyme catalyzes the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation. It binds small non-substrate lipophilic molecules, including biliverdin, bilirubin, retinal, retinoic acid and thyroid hormone, and may act as a scavenger for harmful hydrophobic molecules.
KEGG Pathway
Arachidonic acid metabolism (hsa00590 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Synthesis of Prostaglandins (PG) and Thromboxanes (TX) (R-HSA-2162123 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
DNCB DMDTVYC Immune System disease 4A01-4B41 Phase 2 [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.66E-02 -3.34E-01 -4.84E-01
Alopecia ED70 Skin from scalp 7.55E-05 6.65E-01 1.15E+00
Alzheimer's disease 8A20 Entorhinal cortex 7.17E-02 4.48E-02 1.06E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 9.00E-01 -5.16E-02 -7.00E-02
Aortic stenosis BB70 Calcified aortic valve 2.46E-03 -1.62E+00 -2.01E+00
Apnea 7A40 Hyperplastic tonsil 1.82E-01 9.26E-01 2.81E+00
Arthropathy FA00-FA5Z Peripheral blood 9.31E-01 1.88E-01 4.00E-01
Asthma CA23 Nasal and bronchial airway 6.63E-01 2.88E-03 6.60E-03
Atopic dermatitis EA80 Skin 2.23E-06 -6.74E-01 -1.60E+00
Autism 6A02 Whole blood 7.11E-01 7.10E-02 1.49E-01
Autoimmune uveitis 9A96 Peripheral monocyte 7.60E-02 -7.09E-02 -1.71E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.53E-01 -1.65E-01 -8.49E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.42E-16 1.11E+00 1.56E+00
Batten disease 5C56.1 Whole blood 9.27E-01 3.78E-01 6.22E-01
Behcet's disease 4A62 Peripheral blood 5.32E-01 3.92E-01 5.40E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.35E-01 4.31E-02 1.50E-01
Bladder cancer 2C94 Bladder tissue 3.14E-02 -1.58E+00 -1.27E+00
Breast cancer 2C60-2C6Z Breast tissue 3.00E-36 -1.38E+00 -1.24E+00
Cardioembolic stroke 8B11.20 Whole blood 1.19E-01 -1.99E-01 -2.20E-01
Cervical cancer 2C77 Cervical tissue 3.46E-01 -4.98E-01 -5.39E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.12E-01 -1.60E-01 -3.51E-01
Chronic hepatitis C 1E51.1 Whole blood 6.46E-01 -9.69E-02 -1.84E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.54E-02 -2.70E-01 -3.43E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.05E-01 6.87E-03 2.64E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.93E-01 1.97E-01 1.12E+00
Colon cancer 2B90 Colon tissue 3.46E-03 -2.12E-01 -2.17E-01
Coronary artery disease BA80-BA8Z Peripheral blood 9.46E-03 4.85E-01 2.12E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.53E-01 -7.98E-02 -4.34E-01
Endometriosis GA10 Endometrium tissue 9.95E-01 5.46E-01 3.10E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.10E-01 -4.36E-01 -7.71E-01
Familial hypercholesterolemia 5C80.00 Whole blood 4.81E-01 1.33E-01 2.51E-01
Gastric cancer 2B72 Gastric tissue 1.24E-01 -1.26E+00 -1.47E+00
Glioblastopma 2A00.00 Nervous tissue 1.56E-123 -2.04E+00 -2.06E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.29E-01 -1.21E+00 -2.33E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.15E-01 -8.89E-01 -1.05E+00
Head and neck cancer 2D42 Head and neck tissue 2.61E-01 4.84E-01 2.90E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.42E-01 5.65E-02 1.60E-01
Huntington's disease 8A01.10 Whole blood 2.33E-01 1.56E-01 2.21E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.44E-04 2.19E+00 3.95E+00
Immunodeficiency 4A00-4A20 Peripheral blood 1.73E-01 -3.34E-01 -8.86E-01
Influenza 1E30 Whole blood 2.88E-01 1.07E+00 1.05E+00
Interstitial cystitis GC00.3 Bladder tissue 1.49E-02 2.88E+00 1.97E+00
Intracranial aneurysm 8B01.0 Intracranial artery 6.82E-02 1.01E+00 8.46E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.65E-01 -2.42E-01 -3.04E-01
Ischemic stroke 8B11 Peripheral blood 8.17E-01 1.74E-01 2.26E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.77E-08 -8.10E-01 -1.03E+00
Lateral sclerosis 8B60.4 Skin 1.26E-01 3.66E-01 1.05E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 2.65E-01 -3.77E-01 -2.56E-01
Liver cancer 2C12.0 Liver tissue 3.19E-01 -7.93E-01 -1.37E+00
Liver failure DB99.7-DB99.8 Liver tissue 8.43E-05 2.02E+00 5.48E+00
Lung cancer 2C25 Lung tissue 1.35E-88 -2.15E+00 -2.58E+00
Lupus erythematosus 4A40 Whole blood 6.68E-12 -5.90E-01 -7.91E-01
Major depressive disorder 6A70-6A7Z Hippocampus 1.33E-01 -7.21E-02 -2.58E-01
Major depressive disorder 6A70-6A7Z Whole blood 8.22E-01 -2.78E-01 -3.36E-01
Melanoma 2C30 Skin 7.74E-03 -9.14E-01 -8.17E-01
Multiple myeloma 2A83.1 Peripheral blood 3.91E-01 7.85E-02 4.94E-02
Multiple myeloma 2A83.1 Bone marrow 1.50E-01 -7.52E-02 -2.64E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.11E-01 -2.52E-01 -3.70E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.32E-01 -1.14E-01 -4.12E-01
Myelofibrosis 2A20.2 Whole blood 5.85E-04 -8.50E-01 -2.21E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.81E-01 -2.40E-01 -3.42E-01
Myopathy 8C70.6 Muscle tissue 9.45E-02 6.19E-01 9.22E-01
Neonatal sepsis KA60 Whole blood 2.02E-07 -4.04E-01 -8.41E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.73E-83 -4.69E+00 -5.16E+01
Non-alcoholic fatty liver disease DB92 Liver tissue 5.14E-01 3.14E-01 5.40E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.58E-01 -1.60E-01 -2.86E-01
Olive pollen allergy CA08.00 Peripheral blood 6.56E-02 4.20E-01 1.38E+00
Oral cancer 2B6E Oral tissue 2.29E-03 -9.35E-01 -8.99E-01
Osteoarthritis FA00-FA0Z Synovial tissue 7.40E-01 2.01E-01 1.59E-01
Osteoporosis FB83.1 Bone marrow 9.64E-02 1.28E+00 1.22E+00
Ovarian cancer 2C73 Ovarian tissue 2.12E-01 3.35E-01 2.15E-01
Pancreatic cancer 2C10 Pancreas 3.03E-01 -6.08E-02 -4.64E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 4.26E-01 -7.48E-02 -4.14E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.59E-01 -5.16E-02 -1.05E-01
Pituitary cancer 2D12 Pituitary tissue 2.53E-02 -8.33E-01 -4.09E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.88E-02 -1.14E+00 -5.34E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.80E-01 -1.44E-01 -3.47E-01
Polycythemia vera 2A20.4 Whole blood 8.99E-08 -4.50E-01 -1.15E+00
Pompe disease 5C51.3 Biceps muscle 1.89E-02 7.39E-01 1.72E+00
Preterm birth KA21.4Z Myometrium 9.20E-02 4.30E-01 1.12E+00
Prostate cancer 2C82 Prostate 5.10E-09 -9.25E-01 -1.24E+00
Psoriasis EA90 Skin 2.53E-07 -5.81E-01 -8.34E-01
Rectal cancer 2B92 Rectal colon tissue 3.57E-02 -1.12E+00 -1.28E+00
Renal cancer 2C90-2C91 Kidney 4.79E-03 -2.17E+00 -1.71E+00
Retinoblastoma 2D02.2 Uvea 3.51E-06 -3.33E+00 -7.93E+00
Rheumatoid arthritis FA20 Synovial tissue 4.62E-04 1.99E+00 2.54E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.16E-01 -7.93E-03 -5.08E-02
Schizophrenia 6A20 Prefrontal cortex 3.79E-02 2.36E-02 1.71E-02
Schizophrenia 6A20 Superior temporal cortex 1.45E-01 -6.68E-02 -2.06E-01
Scleroderma 4A42.Z Whole blood 8.25E-05 -1.40E+00 -2.44E+00
Seizure 8A60-8A6Z Whole blood 8.66E-01 1.80E-01 2.32E-01
Sensitive skin EK0Z Skin 3.89E-02 2.92E-01 1.14E+00
Sepsis with septic shock 1G41 Whole blood 1.26E-24 -4.76E-01 -1.09E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.42E-01 -4.70E-01 -1.27E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.50E-01 1.49E-01 4.84E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 6.98E-01 7.39E-02 2.04E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.39E-01 2.76E-02 4.37E-02
Skin cancer 2C30-2C3Z Skin 4.45E-35 -1.62E+00 -1.71E+00
Thrombocythemia 3B63 Whole blood 1.98E-04 -4.23E-01 -1.08E+00
Thrombocytopenia 3B64 Whole blood 5.82E-01 3.79E-01 2.69E-01
Thyroid cancer 2D10 Thyroid 6.94E-11 -9.19E-01 -7.37E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.42E-05 1.81E+00 2.39E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.72E-01 7.70E-01 1.34E+00
Type 2 diabetes 5A11 Liver tissue 1.03E-01 3.81E-01 1.54E+00
Ureter cancer 2C92 Urothelium 8.13E-01 2.09E-02 8.98E-02
Uterine cancer 2C78 Endometrium tissue 2.40E-32 -2.45E+00 -1.50E+00
Vitiligo ED63.0 Skin 9.30E-01 -2.42E-01 -2.31E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Glutathione transferases immobilized on nanoporous alumina: flow system kinetics, screening, and stability. Anal Biochem. 2014 Feb 1;446:59-63.