Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DESTKG6)

DME Name Sulfotransferase 1E1 (SULT1E1)
Synonyms Sulfotransferase family cytosolic 1E member 1; Estrogen sulfotransferase; Estrogen-preferring sulfotransferase; EST-1; ST1E1; STE; SULT1E1
Gene Name SULT1E1
UniProt ID
ST1E1_HUMAN
INTEDE ID
DME0061
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
6783
EC Number EC: 2.8.2.4
Transferase
Sulfotransferase
Sulfotransferase
EC: 2.8.2.4
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MNSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMI
YKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEK
DCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWE
KGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYT
TLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI
Function
This enzyme utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of estradiol and estrone. The sulfation of estrogens leads to their inactivation. It also sulfates dehydroepiandrosterone (DHEA), pregnenolone, (24S)-hydroxycholesterol and xenobiotic compounds like ethinylestradiol, equalenin, diethyl stilbesterol and 1-naphthol at significantly lower efficency.
KEGG Pathway
Steroid hormone biosynthesis (hsa00140 )
Reactome Pathway
Cytosolic sulfonation of small molecules (R-HSA-156584 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Rotigotine DMP7X6Q N. A. N. A. Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.99E-03 -3.50E-02 -3.24E-01
Alopecia ED70 Skin from scalp 7.50E-01 -3.11E-03 -8.49E-03
Alzheimer's disease 8A20 Entorhinal cortex 6.84E-01 -1.40E-02 -1.66E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.65E-01 -1.06E-01 -1.30E+00
Aortic stenosis BB70 Calcified aortic valve 8.08E-01 -2.13E-02 -5.87E-02
Apnea 7A40 Hyperplastic tonsil 8.05E-01 5.91E-02 2.70E-01
Arthropathy FA00-FA5Z Peripheral blood 7.18E-01 6.35E-02 6.90E-01
Asthma CA23 Nasal and bronchial airway 6.98E-01 6.68E-03 5.98E-03
Atopic dermatitis EA80 Skin 1.01E-01 5.16E-01 8.62E-01
Autism 6A02 Whole blood 6.64E-01 -2.97E-02 -3.04E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.02E-01 -4.81E-02 -4.84E-01
Autosomal dominant monocytopenia 4B04 Whole blood 6.52E-01 2.65E-02 1.82E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.36E-09 3.58E-01 1.10E+00
Batten disease 5C56.1 Whole blood 5.18E-01 5.55E-02 1.28E+00
Behcet's disease 4A62 Peripheral blood 8.78E-01 -2.90E-02 -2.84E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.20E-01 3.25E-02 3.22E-01
Bladder cancer 2C94 Bladder tissue 8.82E-02 2.45E-01 2.75E-01
Breast cancer 2C60-2C6Z Breast tissue 2.53E-05 -2.47E-02 -1.44E-01
Cardioembolic stroke 8B11.20 Whole blood 7.40E-01 -3.53E-02 -2.04E-01
Cervical cancer 2C77 Cervical tissue 1.26E-02 -1.23E+00 -9.38E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.11E-01 9.75E-03 8.10E-02
Chronic hepatitis C 1E51.1 Whole blood 9.76E-01 -7.61E-03 -9.96E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 3.92E-01 -1.32E-02 -9.10E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.25E-09 -1.78E-01 -1.78E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.04E-01 -9.69E-01 -9.70E-01
Colon cancer 2B90 Colon tissue 3.81E-02 -6.10E-02 -1.51E-01
Coronary artery disease BA80-BA8Z Peripheral blood 6.75E-01 -7.85E-02 -4.93E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.96E-01 4.07E-02 3.77E-01
Endometriosis GA10 Endometrium tissue 4.08E-02 1.99E-02 1.91E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.75E-01 -1.15E-02 -1.09E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.44E-01 -2.33E-02 -2.16E-01
Gastric cancer 2B72 Gastric tissue 4.34E-02 -6.74E-02 -2.06E-01
Glioblastopma 2A00.00 Nervous tissue 4.68E-05 -5.00E-02 -1.99E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.61E-01 8.70E-03 1.50E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.42E-04 -3.33E-01 -1.85E+00
Head and neck cancer 2D42 Head and neck tissue 1.17E-01 1.98E-01 1.33E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.80E-01 -9.55E-03 -5.15E-02
Huntington's disease 8A01.10 Whole blood 8.85E-01 -3.87E-02 -5.06E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.04E-01 2.07E-01 6.39E-01
Immunodeficiency 4A00-4A20 Peripheral blood 8.44E-01 2.99E-02 3.82E-01
Influenza 1E30 Whole blood 1.79E-01 1.04E-01 1.06E+00
Interstitial cystitis GC00.3 Bladder tissue 2.69E-01 -2.37E-01 -2.58E-01
Intracranial aneurysm 8B01.0 Intracranial artery 2.45E-02 3.28E-01 3.12E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.79E-01 5.75E-02 2.05E-01
Ischemic stroke 8B11 Peripheral blood 5.51E-01 3.52E-02 2.34E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.13E-02 7.76E-02 4.15E-01
Lateral sclerosis 8B60.4 Skin 1.93E-01 -1.32E-01 -1.05E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 3.83E-02 1.50E-01 1.62E+00
Liver cancer 2C12.0 Liver tissue 5.44E-05 -2.17E+00 -1.44E+00
Liver failure DB99.7-DB99.8 Liver tissue 8.45E-01 2.47E-01 2.26E-01
Lung cancer 2C25 Lung tissue 7.92E-03 -9.31E-02 -2.74E-01
Lupus erythematosus 4A40 Whole blood 7.36E-12 8.30E-02 4.80E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.50E-01 4.85E-02 4.63E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.68E-01 -8.24E-03 -3.64E-02
Melanoma 2C30 Skin 3.98E-03 -1.33E+00 -8.79E-01
Multiple myeloma 2A83.1 Peripheral blood 9.58E-01 6.65E-03 1.06E-01
Multiple myeloma 2A83.1 Bone marrow 4.29E-02 -8.61E-02 -7.34E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.73E-01 1.24E-01 6.09E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.95E-01 -3.20E-02 -3.71E-01
Myelofibrosis 2A20.2 Whole blood 8.46E-02 1.91E-01 1.79E+00
Myocardial infarction BA41-BA50 Peripheral blood 2.69E-01 1.13E-01 1.33E-01
Myopathy 8C70.6 Muscle tissue 3.71E-01 -3.64E-02 -2.73E-01
Neonatal sepsis KA60 Whole blood 1.61E-01 2.59E-02 1.96E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 7.23E-01 -2.07E-01 -1.56E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 8.49E-01 -1.11E-01 -9.98E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.06E-01 9.04E-02 1.86E+00
Olive pollen allergy CA08.00 Peripheral blood 1.29E-01 2.38E-01 1.41E+00
Oral cancer 2B6E Oral tissue 3.36E-04 1.46E-01 2.60E-01
Osteoarthritis FA00-FA0Z Synovial tissue 4.82E-01 -1.17E-02 -1.12E-01
Osteoporosis FB83.1 Bone marrow 7.10E-02 9.57E-02 1.54E+00
Ovarian cancer 2C73 Ovarian tissue 4.43E-01 -1.11E-01 -9.12E-01
Pancreatic cancer 2C10 Pancreas 2.14E-01 1.92E-01 1.56E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.34E-01 -1.00E-01 -9.74E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.45E-01 -5.94E-02 -7.49E-01
Pituitary cancer 2D12 Pituitary tissue 1.85E-01 5.78E-02 6.32E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.41E-01 -6.92E-05 -8.28E-04
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.89E-01 -2.77E-02 -3.72E-01
Polycythemia vera 2A20.4 Whole blood 2.81E-09 1.16E-01 1.51E+00
Pompe disease 5C51.3 Biceps muscle 1.03E-01 -2.07E-01 -2.17E+00
Preterm birth KA21.4Z Myometrium 6.17E-01 2.25E-02 2.24E-01
Prostate cancer 2C82 Prostate 2.32E-01 2.88E-01 3.18E-01
Psoriasis EA90 Skin 1.90E-21 9.62E-01 1.19E+00
Rectal cancer 2B92 Rectal colon tissue 1.18E-01 -1.03E-01 -7.06E-01
Renal cancer 2C90-2C91 Kidney 2.18E-01 -1.34E-01 -4.82E-02
Retinoblastoma 2D02.2 Uvea 1.41E-01 -8.23E-02 -1.22E+00
Rheumatoid arthritis FA20 Synovial tissue 5.51E-02 -1.74E-01 -1.14E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.05E-02 -8.67E-02 -1.90E-01
Schizophrenia 6A20 Prefrontal cortex 3.32E-01 3.78E-03 3.99E-02
Schizophrenia 6A20 Superior temporal cortex 4.70E-01 4.32E-02 6.46E-01
Scleroderma 4A42.Z Whole blood 6.49E-02 -9.97E-02 -8.27E-01
Seizure 8A60-8A6Z Whole blood 6.77E-01 9.99E-03 1.40E-01
Sensitive skin EK0Z Skin 4.67E-02 2.97E-01 1.18E+00
Sepsis with septic shock 1G41 Whole blood 6.57E-02 2.00E-02 1.41E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.73E-01 6.47E-02 3.46E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.41E-01 1.61E-02 1.76E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.04E-01 2.84E-02 5.24E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.52E-01 -2.39E-03 -4.50E-02
Skin cancer 2C30-2C3Z Skin 4.15E-17 -1.15E+00 -1.12E+00
Thrombocythemia 3B63 Whole blood 7.05E-07 1.09E-01 1.10E+00
Thrombocytopenia 3B64 Whole blood 7.19E-01 -1.09E-02 -8.02E-02
Thyroid cancer 2D10 Thyroid 9.45E-01 2.90E-02 1.41E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.60E-01 -8.98E-04 -6.57E-03
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.62E-01 7.67E-03 8.82E-02
Type 2 diabetes 5A11 Liver tissue 9.70E-01 -1.19E-01 -2.39E-01
Ureter cancer 2C92 Urothelium 4.64E-02 4.41E-02 3.43E-01
Uterine cancer 2C78 Endometrium tissue 6.91E-02 -9.81E-02 -7.79E-02
Vitiligo ED63.0 Skin 5.09E-01 1.52E-01 4.70E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Identification of the human SULT enzymes involved in the metabolism of rotigotine. J Clin Pharmacol. 2016 Jun;56(6):754-60.