Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEVEFKM)

DME Name Alkaline phosphatase (ALPL)
Synonyms Alkaline phosphatase liver/bone/kidney isozyme; Alkaline phosphatase tissue-nonspecific isozyme; ALPL; AP-TNAP; TNSALP
Gene Name ALPL
UniProt ID
PPBT_HUMAN
INTEDE ID
DME0079
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
249
EC Number EC: 3.1.3.1
Hydrolases
Ester bond hydrolase
Phosphoric monoester hydrolase
EC: 3.1.3.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGD
GMGVSTVTAARILKGQLHHNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCG
VKANEGTVGVSAATERSRCNTTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAH
SADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDVIMGGGRKYMYPKNKTDVEYESDE
KARGTRLDGLDLVDTWKSFKPRYKHSHFIWNRTELLTLDPHNVDYLLGLFEPGDMQYELN
RNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDRAIG
QAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGNGPG
YKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYV
PHVMAYAACIGANLGHCAPASSAGSLAAGPLLLALALYPLSVLF
Function This enzyme plays a key role in skeletal mineralization by regulating levels of diphosphate (PPi).
KEGG Pathway
Folate biosynthesis (hsa00790 )
Metabolic pathways (hsa01100 )
Thiamine metabolism (hsa00730 )
Reactome Pathway
Post-translational modification-synthesis of GPI-anchored proteins (R-HSA-163125 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
3 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Amifostine DM5FL14 Mucositis CA00 Approved [5]
Fospropofol DM8J5XT N. A. N. A. Approved [6]
Fostamatinib DM6AUHV Immune thrombocytopenic purpura 3B64.13 Approved []

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.21E-02 -5.16E-02 -7.52E-02
Alopecia ED70 Skin from scalp 3.04E-01 4.89E-02 2.02E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.82E-01 -1.54E-01 -4.70E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.77E-01 8.36E-02 3.98E-01
Aortic stenosis BB70 Calcified aortic valve 4.28E-01 1.30E-01 3.94E-01
Apnea 7A40 Hyperplastic tonsil 3.51E-01 -1.07E-01 -6.62E-01
Arthropathy FA00-FA5Z Peripheral blood 1.20E-02 7.61E-01 1.53E+00
Asthma CA23 Nasal and bronchial airway 3.80E-01 2.80E-02 3.97E-02
Atopic dermatitis EA80 Skin 2.84E-05 1.19E-01 9.18E-01
Autism 6A02 Whole blood 9.62E-01 7.15E-03 9.51E-03
Autoimmune uveitis 9A96 Peripheral monocyte 1.22E-01 5.42E-01 4.49E+00
Autosomal dominant monocytopenia 4B04 Whole blood 7.67E-01 4.57E-01 8.19E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.18E-14 6.20E-01 1.37E+00
Batten disease 5C56.1 Whole blood 3.58E-01 5.24E-02 6.39E-01
Behcet's disease 4A62 Peripheral blood 1.39E-01 1.24E-01 6.31E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.13E-01 -6.01E-02 -3.55E-01
Bladder cancer 2C94 Bladder tissue 1.38E-04 4.29E-01 2.36E+00
Breast cancer 2C60-2C6Z Breast tissue 1.15E-27 -4.33E-01 -7.96E-01
Cardioembolic stroke 8B11.20 Whole blood 3.77E-01 1.31E-01 1.83E-01
Cervical cancer 2C77 Cervical tissue 1.06E-01 2.34E-02 1.48E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.61E-01 2.21E-01 8.84E-02
Chronic hepatitis C 1E51.1 Whole blood 4.44E-02 1.21E-01 2.14E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 6.17E-01 5.30E-02 7.55E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.82E-01 -2.77E-01 -3.32E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.62E-01 2.21E-01 7.38E-01
Colon cancer 2B90 Colon tissue 4.67E-13 -1.53E-01 -7.88E-01
Coronary artery disease BA80-BA8Z Peripheral blood 2.16E-01 -6.30E-02 -5.32E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.78E-01 9.24E-02 4.55E-01
Endometriosis GA10 Endometrium tissue 1.22E-03 -1.10E+00 -9.04E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.40E-01 -5.68E-03 -4.09E-02
Familial hypercholesterolemia 5C80.00 Whole blood 8.77E-14 -1.36E+00 -1.55E+00
Gastric cancer 2B72 Gastric tissue 8.46E-01 -4.71E-02 -3.38E-01
Glioblastopma 2A00.00 Nervous tissue 2.79E-46 -5.41E-01 -1.15E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.58E-01 5.94E-02 3.89E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 9.33E-02 -2.04E-01 -6.35E-01
Head and neck cancer 2D42 Head and neck tissue 3.64E-08 -1.36E-01 -1.13E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.51E-01 -9.51E-02 -4.28E-01
Huntington's disease 8A01.10 Whole blood 7.91E-01 -1.29E-02 -9.43E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.42E-01 -3.86E-01 -9.56E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.25E-01 5.57E-02 8.77E-01
Influenza 1E30 Whole blood 7.74E-04 3.34E-01 1.33E+01
Interstitial cystitis GC00.3 Bladder tissue 9.97E-03 3.70E-01 6.83E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.09E-02 2.56E-01 7.96E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.46E-01 4.73E-02 2.42E-01
Ischemic stroke 8B11 Peripheral blood 1.25E-01 2.08E-02 2.13E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 8.17E-02 1.24E-01 1.03E-01
Lateral sclerosis 8B60.4 Skin 5.88E-01 -1.49E-02 -4.59E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 8.05E-01 4.47E-02 3.90E-01
Liver cancer 2C12.0 Liver tissue 1.02E-10 -1.24E+00 -1.51E+00
Liver failure DB99.7-DB99.8 Liver tissue 2.18E-01 -2.42E-01 -4.97E-01
Lung cancer 2C25 Lung tissue 1.10E-39 -1.40E+00 -1.43E+00
Lupus erythematosus 4A40 Whole blood 9.17E-06 6.42E-01 6.69E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.26E-01 -4.00E-02 -2.33E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.31E-01 1.29E-01 2.17E-01
Melanoma 2C30 Skin 4.34E-01 -3.12E-03 -8.30E-03
Multiple myeloma 2A83.1 Peripheral blood 3.22E-01 -4.17E-02 -3.54E-01
Multiple myeloma 2A83.1 Bone marrow 2.14E-02 -1.36E-01 -9.58E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.26E-01 3.79E-03 2.29E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.76E-01 5.33E-04 3.38E-03
Myelofibrosis 2A20.2 Whole blood 6.15E-01 -1.30E-01 -2.95E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.91E-06 9.89E-01 1.54E+00
Myopathy 8C70.6 Muscle tissue 6.91E-01 -1.50E-02 -9.72E-02
Neonatal sepsis KA60 Whole blood 2.00E-22 1.92E+00 2.29E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 8.72E-05 -4.84E-01 -2.56E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.62E-01 -7.94E-02 -1.75E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.84E-03 1.63E-01 2.40E+00
Olive pollen allergy CA08.00 Peripheral blood 3.31E-02 2.45E-01 2.16E+00
Oral cancer 2B6E Oral tissue 4.69E-02 -1.63E-01 -6.36E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.91E-01 -6.75E-02 -3.19E-01
Osteoporosis FB83.1 Bone marrow 1.27E-01 9.74E-01 4.09E+00
Ovarian cancer 2C73 Ovarian tissue 4.54E-03 4.39E-01 1.08E+00
Pancreatic cancer 2C10 Pancreas 2.17E-03 -4.76E-01 -1.55E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 3.93E-01 -6.83E-02 -1.85E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.32E-03 3.55E-01 2.23E+00
Pituitary cancer 2D12 Pituitary tissue 7.90E-01 8.44E-02 1.71E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.81E-01 -7.01E-02 -1.15E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.47E-01 1.50E-01 1.09E+00
Polycythemia vera 2A20.4 Whole blood 1.46E-03 2.75E-01 6.15E-01
Pompe disease 5C51.3 Biceps muscle 3.21E-01 1.07E-01 8.24E-01
Preterm birth KA21.4Z Myometrium 3.00E-01 -1.25E-01 -4.74E-01
Prostate cancer 2C82 Prostate 1.70E-01 -2.97E-01 -7.00E-01
Psoriasis EA90 Skin 2.18E-01 3.70E-02 1.59E-01
Rectal cancer 2B92 Rectal colon tissue 7.77E-01 -3.55E-02 -1.87E-01
Renal cancer 2C90-2C91 Kidney 1.69E-01 -7.19E-01 -1.02E+00
Retinoblastoma 2D02.2 Uvea 3.27E-07 -1.28E+00 -2.68E+00
Rheumatoid arthritis FA20 Synovial tissue 6.17E-04 9.15E-01 2.54E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.21E-01 -1.19E-01 -1.75E-01
Schizophrenia 6A20 Prefrontal cortex 4.41E-02 -1.25E-01 -4.65E-01
Schizophrenia 6A20 Superior temporal cortex 8.80E-01 3.54E-02 1.81E-01
Scleroderma 4A42.Z Whole blood 1.83E-01 -2.78E-02 -4.50E-02
Seizure 8A60-8A6Z Whole blood 3.71E-01 1.14E-01 1.04E-01
Sensitive skin EK0Z Skin 8.31E-01 2.03E-02 2.16E-01
Sepsis with septic shock 1G41 Whole blood 9.10E-100 2.30E+00 3.01E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.23E-02 4.32E-01 1.99E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.76E-01 7.64E-02 4.84E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.38E-01 -5.59E-02 -4.20E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.11E-01 -6.44E-02 -3.62E-01
Skin cancer 2C30-2C3Z Skin 9.47E-09 1.12E-01 4.20E-01
Thrombocythemia 3B63 Whole blood 9.46E-02 -1.40E-01 -3.14E-01
Thrombocytopenia 3B64 Whole blood 4.16E-01 1.29E-01 6.91E-01
Thyroid cancer 2D10 Thyroid 1.69E-20 3.12E-01 1.43E+00
Tibial muscular dystrophy 8C75 Muscle tissue 9.91E-01 8.47E-02 5.00E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.61E-01 -1.72E-01 -6.23E-01
Type 2 diabetes 5A11 Liver tissue 1.13E-01 -2.80E-01 -7.28E-01
Ureter cancer 2C92 Urothelium 7.86E-01 3.90E-02 2.72E-01
Uterine cancer 2C78 Endometrium tissue 2.10E-11 -6.03E-01 -6.15E-01
Vitiligo ED63.0 Skin 2.87E-02 -2.35E-01 -2.40E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Alkaline phosphatase tissue-nonspecific (ALPL) DTT Info
DME DTT Type Successful
2 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Asfotase alfa DMM4FXA Genetic disease 8E02 Approved [1]
Levamisole DM5EN79 Parasitic infection 1D0Y-1G2Z Approved [2]
3 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
DS-1211 DMY3T0L Pseudoxanthoma elasticum EC40 Phase 2 [3]
ALXN1850 DMSQPCT Hypophosphatasia 5C64.3 Phase 1 [4]
ALXN1910 DMDXTAE Discovery agent N.A. Phase 1 [4]

References

1 Enzyme-replacement therapy in life-threatening hypophosphatasia. N Engl J Med. 2012 Mar 8;366(10):904-13.
2 Characterization of rat heart alkaline phosphatase isoenzymes and modulation of activity. Braz J Med Biol Res. 2008 Jul;41(7):600-9.
3 In Vitro and In Vivo Pharmacological Profiles of DS-1211, a Novel Potent, Selective, and Orally Bioavailable Tissue-Nonspecific Alkaline Phosphatase Inhibitor. J Bone Miner Res. 2022 Oct;37(10):2033-2043.
4 Clinical pipeline report, company report or official report of Alexion
5 Pharmacokinetic profile of amifostine. Semin Oncol. 1996 Aug;23(4 Suppl 8):18-22.
6 A double-blind, randomized, multicenter, dose-ranging study to evaluate the safety and efficacy of fospropofol disodium as an intravenous sedative for colonoscopy in high-risk populations. Am J Ther. 2013 Mar-Apr;20(2):163-71.